Transcription Factor

Accessions: T012790_1.02 (CISBP 1.02), Q18054 (JASPAR 2024)
Names: hlh-25, T012790_1.02;, Q18054_CAEEL
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q18054
Notes: experiment type:PBM, family:bHLH
Length: 268
Pfam Domains: 93-148 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MPKVIQSSMSDYRSVPYNQTPKSASERKRRNITNELINECKTIVQKSEEEHISQEVVLFR 60
61 IVKLVTGVNLESNFSSNDLSESTRRKFDTESERRKVKTEREKIRRKKQDDCYAELKFFIL 120
121 NKQMGSYEQRLKLERITILEIIIDYIKHNSDLLYPETIPQILPLLAGKSTATCENKENEK 180
181 PKTRMEVKDLFPRLTFQEVQESPTSTSPLLTFPCIPMIPTTQFNVLSNYNTVPSIFSAPL 240
241 RFILPSLQILTPETSDEEENEETLDIIN
Interface Residues: 94, 98, 100, 101, 104, 105
3D-footprint Homologues: 2ypa_A
Binding Motifs: PL0018.1 rrgrCGCGTGTCCywk
M0170_1.02 saCAYGCG
UN0704.1 CGCRTGts
Publications: Grove C.A, De Masi F, Barrasa M.I, Newburger D.E, Alkema M.J, Bulyk M.L, Walhout A.J. A multiparameter network reveals extensive divergence between C. elegans bHLH transcription factors. Cell 138:314-27 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.