Transcription Factor

Accessions: E2Fd (Athamap 20091028), T25720 (AthalianaCistrome v4_May2016), Q9LFQ9 (JASPAR 2020)
Names: DEL2, DP-E2F-like protein 2, E2F transcription factor-like E2FD, E2F-like repressor E2L1, E2Fd, E2L1, AT5G14960, T25720;, E2FD_ARATH
Organisms: Arabidopsis thaliana
Libraries: Athamap 20091028 1, AthalianaCistrome v4_May2016 2, JASPAR 2020 3
1 B├╝low L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
3 [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:E2F-DP
Length: 359
Pfam Domains: 13-78 E2F/DP family winged-helix DNA-binding domain
138-217 E2F/DP family winged-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MDSLALAPQVYSRKDKSLGVLVANFLTLYNRPDVDLFGLDDAAAKLGVERRRIYDVVNIL 60
61 ESIGLVARSGKNQYSWKGFGAVPRALSELKEEGMKEKFAIVPFVAKSEMVVYEKEGEESF 120
121 MLSPDDQEFSPSPRPDNRKERTLWLLAQNFVKLFLCSDDDLVTFDSATKALLNESQDMNM 180
181 RKKVRRLYDIANVFSSMKLIEKTHVPETKKPAYRWLGSKTIFENRFIDGSASLCDRNVPK 240
241 KRAFGTELTNVNAKRNKSGCSKEDSKRNGNQNTSIVIKQEQCDDVKPDVKNFASGSSTPA 300
301 GTSESNDMGNNIRPRGRLGVIEALSTLYQPSYCNPELLGLFAHYNETFRSYQEEFGREK
Interface Residues: 13, 49, 50, 51, 52, 54, 55, 56, 68, 185, 186, 188
3D-footprint Homologues: 1cf7_A, 4yo2_A, 4fx4_B, 1cf7_B
Binding Motifs: E2Fd TTCCCGCcmww
M0363 wwwwdtTTTTGGCGGGAAAA
M0366 tTTTTGGCGGGAAAA
UN0361.1 TTTGGCGGGAAAAttw
Binding Sites: UN0361.1.4
E2Fd_1
E2Fd_2
E2Fd_3
E2Fd_4
E2Fd_5
UN0361.1.1
UN0361.1.10
UN0361.1.11
UN0361.1.12
UN0361.1.13
UN0361.1.14
UN0361.1.15 / UN0361.1.7
UN0361.1.16
UN0361.1.17
UN0361.1.18
UN0361.1.19
UN0361.1.2
UN0361.1.20
UN0361.1.3
UN0361.1.5
UN0361.1.6
UN0361.1.8
UN0361.1.9
Publications: Mariconti L, Pellegrini B, Cantoni R, Stevens R, Bergounioux C, Cella R, Albani D. 2002. The E2F family of transcription factors from Arabidopsis thaliana. Novel and conserved components of the retinoblastoma/E2F pathway in plants. J Biol Chem. 277:9911-9. [Pubmed]

Egelkrout EM, Mariconti L, Settlage SB, Cella R, Robertson D, Hanley-Bowdoin L. 2002. Two E2F elements regulate the proliferating cell nuclear antigen promoter differently during leaf development. Plant Cell. 14:3225-36. [Pubmed]

Stevens R, Mariconti L, Rossignol P, Perennes C, Cella R, Bergounioux C. 2002. Two E2F sites in the Arabidopsis MCM3 promoter have different roles in cell cycle activation and meristematic expression. J Biol Chem. 277:32978-84. [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.