Transcription Factor

Accessions: A1JVI8 (JASPAR 2018)
Names: A1JVI8_MOUSE
Organisms: Mus musculus
Libraries: JASPAR 2018 1
1 [Pubmed]
Uniprot: A1JVI8
Length: 674
Pfam Domains: 19-72 Homeobox domain
113-168 Homeobox domain
Sequence:
(in bold interface residues)
1 MAEAGSPVGGSGVARESRRRRKTVWQAWQEQALLSTFKKKRYLSFKERKELAKRMGVSDC 60
61 RIRVWFQNRRNRSGEEGHASKRSIRGSRRLASPQLQEELGSRPQGRGMRSSGRRPRTRLT 120
121 SLQLRILGQAFERNPRPGFATREELARDTGLPEDTIHIWFQNRRARRRHRRGRPTAQDQD 180
181 LLASQGSDGAPAGPEGREREGAQENLLPQEEAGSTGMDTSSPSDLPSFCGESQPFQVAQP 240
241 RGAGQQEAPTRAGNAGSLEPLLDQLLDEVQVEEPAPAPLNLDGDPGGRVHEGSQESFWPQ 300
301 EEAGSTGMDTSSPSDSNSFCRESQPSQVAQPCGAGQEDARTQADSTGPLELLLLDQLLDE 360
361 VQKEEHVPVPLDWGRNPGSREHEGSQDSLLPLEEAVNSGMDTSIPSIWPTFCRESQPPQV 420
421 AQPSGPGQAQAPTQGGNTDPLELFLYQLLDEVQVEEHAPAPLNWDVDPGGRVHEGSWESF 480
481 WPQEEAGSTGLDTSSPSDSNSFFRESKPSQVAQRRGAGQEDARTQADSTGPLELLLFDQL 540
541 LDEVQKEEHVPAPLDWGRNPGSMEHEGSQDSLLPLEEAANSGRDTSIPSIWPAFCRKSQP 600
601 PQVAQPSGPGQAQAPIQGGNTDPLELFLDQLLTEVQLEEQGPAPVNVEETWEQMDTTPDL 660
661 PLTSEEYQTLLDML
Interface Residues: 19, 20, 21, 22, 60, 63, 64, 67, 68, 71, 72, 113, 114, 115, 116, 118, 154, 155, 157, 158, 161, 162, 165, 166, 167, 168, 169
3D-footprint Homologues: 1puf_A, 2h1k_B, 4rdu_A, 2me6_A, 1nk3_P, 2r5z_A, 1zq3_P, 5lty_K, 5lux_L, 1gt0_C, 5jlw_D, 2hos_A, 4xrs_G, 4cyc_A, 2hdd_A, 1au7_A, 1le8_A, 4qtr_D, 3rkq_B, 4rbo_D, 3a01_E, 3cmy_A, 1ig7_A, 3d1n_M, 1fjl_B, 1jgg_B, 2lkx_A, 3lnq_A, 2ld5_A, 1b72_A, 2d5v_B, 5eea_B, 1puf_B, 5hod_A, 3l1p_A, 1e3o_C, 2xsd_C, 4cyc_B, 4xrm_B
Binding Motifs: MA0611.1 sCAATCAa
Publications: Young JM, Whiddon JL, Yao Z, Kasinathan B, Snider L, Geng LN, Balog J, Tawil R, van der Maarel SM, Tapscott SJ. DUX4 binding to retroelements creates promoters that are active in FSHD muscle and testis. PLoS Genet : (2013). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.