Transcription Factor
| Accessions: | wor (FlyZincFinger 1.0 ) |
| Names: | CG4158 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 230 |
| Pfam Domains: | 11-33 Zinc finger, C2H2 type 11-33 C2H2-type zinc finger 11-33 C2H2-type zinc finger 88-110 Zinc finger, C2H2 type 88-112 C2H2-type zinc finger 88-110 C2H2-type zinc finger 103-133 Zinc-finger double domain 122-145 C2H2-type zinc finger 123-145 Zinc finger, C2H2 type 123-145 C2H2-type zinc finger 137-160 Zinc-finger double domain 150-171 Zinc finger, C2H2 type 150-168 C2H2-type zinc finger 150-171 C2H2-type zinc finger 164-187 Zinc-finger double domain 177-199 C2H2-type zinc finger 177-199 Zinc finger, C2H2 type 177-199 Zinc-finger double-stranded RNA-binding 177-200 C2H2-type zinc finger 177-197 Zinc-finger of C2H2 type 191-216 Zinc-finger double domain 205-225 C2H2-type zinc finger 205-228 Zinc finger, C2H2 type 205-229 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 LKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQPGGSGAIVDQTEFC 60 61 TDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVK 120 121 KVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQ 180 181 HCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQT |
| Interface Residues: | 69, 71, 72, 98, 99, 101, 102, 105, 109, 133, 134, 135, 136, 137, 139, 140, 142, 143, 146, 159, 160, 161, 162, 163, 165, 166, 187, 188, 189, 190, 191, 192, 193, 194, 195, 198, 215, 216, 217, 218, 219, 220, 221, 222, 223 |
| 3D-footprint Homologues: | 2i13_A, 7w1m_H, 8ssq_A, 5kkq_D, 5yel_A, 1ubd_C, 6jnm_A, 7n5w_A, 5und_A, 8ssu_A, 6ml4_A, 4x9j_A, 5ei9_F, 7eyi_G, 8h9h_G, 7ysf_A, 6wmi_A, 6e94_A, 6a57_A, 2jpa_A, 1tf3_A, 8cuc_F, 7y3l_A, 3uk3_C, 1f2i_J, 5k5i_A, 2kmk_A, 2gli_A, 1g2f_F, 1tf6_A, 5v3j_F, 8gn3_A, 1llm_D, 6blw_A, 2wbs_A, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 2lt7_A, 7y3m_I, 2drp_D, 5yj3_D, 5k5l_F, 4m9v_C |
| Binding Motifs: | wor_SANGER_2.5_FBgn0001983 CACCTGy wor_SOLEXA_2.5_FBgn0001983 mCACCTGy |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.