Transcription Factor
Accessions: | OTX2_HUMAN (HOCOMOCO 10), P32243 (JASPAR 2024) |
Names: | Homeobox protein OTX2, Orthodenticle homolog 2, OTX2_HUMAN |
Organisms: | Homo sapiens |
Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 289 |
Pfam Domains: | 39-95 Homeobox domain 153-235 Otx1 transcription factor |
Sequence: (in bold interface residues) | 1 MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKT 60 61 RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPARE 120 121 VSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYT 180 181 QASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLST 240 241 QGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL |
Interface Residues: | 17, 21, 38, 39, 40, 41, 42, 80, 81, 83, 84, 87, 88, 91, 92, 95 |
3D-footprint Homologues: | 1e3o_C, 4j19_B, 2h1k_B, 1puf_A, 3d1n_M, 5zfz_A, 1fjl_B, 1ig7_A, 6a8r_A, 3cmy_A, 1jgg_B, 2lkx_A, 1nk2_P, 1zq3_P, 3lnq_A, 6es3_K, 7q3o_C, 2ld5_A, 7psx_B, 5jlw_D, 3rkq_B, 4xrs_G, 2hdd_A, 1au7_A, 4cyc_A, 2r5y_A, 1puf_B, 6m3d_C, 5flv_I, 3l1p_A, 2hos_A, 1b72_A, 5zjt_E, 3a01_E, 5hod_A, 1le8_A, 8g87_X, 6wig_A, 1o4x_A, 1du0_A, 4qtr_D |
Binding Motifs: | MA0712.1 tTAATCCb OTX2_HUMAN.H10MO.C|M01409 kwkmwrGGATTArak MA0712.2 wdrGGATTAraw MA0712.3 rGGATTA |
Binding Sites: | MA0712.2.1 MA0712.2.10 / MA0712.2.13 MA0712.2.11 / MA0712.2.14 MA0712.2.12 / MA0712.2.15 MA0712.2.13 / MA0712.2.16 MA0712.2.14 / MA0712.2.17 MA0712.2.15 / MA0712.2.18 MA0712.2.16 / MA0712.2.19 MA0712.2.17 / MA0712.2.20 MA0712.2.18 MA0712.2.19 MA0712.2.2 / MA0712.2.3 MA0712.2.20 MA0712.2.3 / MA0712.2.4 MA0712.2.4 / MA0712.2.5 MA0712.2.5 / MA0712.2.6 MA0712.2.6 / MA0712.2.7 MA0712.2.7 / MA0712.2.9 MA0712.2.10 / MA0712.2.8 MA0712.2.12 / MA0712.2.9 MA0712.2.11 MA0712.2.2 MA0712.2.8 MA0712.3.1 MA0712.3.10 / MA0712.3.12 / MA0712.3.13 / MA0712.3.14 / MA0712.3.17 / MA0712.3.19 / MA0712.3.20 / MA0712.3.3 / MA0712.3.4 / MA0712.3.6 / MA0712.3.7 MA0712.3.11 MA0712.3.15 MA0712.3.16 MA0712.3.18 MA0712.3.2 MA0712.3.5 MA0712.3.8 MA0712.3.9 |
Publications: | Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.