Transcription Factor

Accessions: T028099_1.02 (CISBP 1.02), P40535 (JASPAR 2018)
Names: CST6, T028099_1.02;, ACA2_YEAST, ATF/CREB activator 2, Chromosome stability protein CST6
Organisms: Saccharomyces cerevisiae
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:bZIP
Length: 587
Pfam Domains: 425-483 bZIP transcription factor
432-472 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATTTSTMNNSALSR 60
61 SLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIAAGNVNSHDRVVKPSANSNYQQA 120
121 AYLRQQQQQDQRQQSPSMKTEEESQLYGDILMNSGVVQDMHQNLATHTNLSQLSSTRKSA 180
181 PNDSTTAPTNASNIANTASVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAH 240
241 LPMTNPPIFQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHNYN 300
301 GLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYSKSQQRNFVNAPS 360
361 KNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNPSFTPKSQGSHLNLAANTQGNPI 420
421 PGTTAWKRARLLERNRIAASKCRQRKKVAQLQLQKEFNEIKDENRILLKKLNYYEKLISK 480
481 FKKFSKIHLREHEKLNKDSDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDT 540
541 GKIIAIKHEPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK
Interface Residues: 431, 435, 436, 438, 439, 442, 443
3D-footprint Homologues: 2wt7_A, 1dh3_C, 5t01_B, 1t2k_D, 5vpe_C, 2e42_A, 5vpe_D
Binding Motifs: M0355_1.02 RTGACGTm
MA0286.1 rTGACGTma
Publications: Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.