Transcription Factor

						

			
Accessions: T117025_1.02 (CISBP 1.02), Q9FJW5 (JASPAR 2024), T25713 (AthalianaCistrome v4_May2016)

			
Names: ATTRB2, T117025_1.02;, AtTBP3, MYB transcription factor, Telomere repeat-binding factor 2, Telomere-binding protein 3, TRB2_ARATH, AT5G67580, T25713;, TBP3
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]

2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]

3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: experiment type:PBM, family:Myb/SANT, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:MYB-related
Length: 299
Pfam Domains:      5-55 Myb-like DNA-binding domain
     8-58 Myb-like DNA-binding domain
  125-182 linker histone H1 and H5 family
Sequence: 
(in bold interface residues)		   1 MGAPKQKWTPEEEAALKAGVLKHGTGKWRTILSDTEFSLILKSRSNVDLKDKWRNISVTA   60
  61 LWGSRKKAKLALKRTPPGTKQDDNNTALTIVALTNDDERAKPTSPGGSGGGSPRTCASKR  120
 121 SITSLDKIIFEAITNLRELRGSDRTSIFLYIEENFKTPPNMKRHVAVRLKHLSSNGTLVK  180
 181 IKHKYRFSSNFIPAGARQKAPQLFLEGNNKKDPTKPEENGANSLTKFRVDGELYMIKGMT  240
 241 AQEAAEAAARAVAEAEFAITEAEQAAKEAERAEAEAEAAQIFAKAAMKALKFRIRNHPW
Interface Residues: 5, 46, 47, 50, 51, 54, 55
3D-footprint Homologues: 7c4r_A, 1vfc_A, 3osg_A, 1w0t_A, 2qhb_A, 7xur_A, 3zqc_A, 2kdz_A
Binding Motifs: M1346_1.02 wrmCCTAr
MA1073.1 wrmCCTAr
M0604 awwwhtwwrCCCTAAwtwy
M0621 rrwTTAGGGYTtaddkttk
			
Publications: Zhong R, Ye ZH. MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes. Plant Cell Physiol 53:368-80 (2012). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.