Transcription Factor

Accessions: T093342_1.02 (CISBP 1.02), P28360 (JASPAR 2024)
Names: MSX1, T093342_1.02;, Homeobox protein Hox-7, Homeobox protein MSX-1, Msh homeobox 1-like protein, MSX1_HUMAN
Organisms: Homo sapiens
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: family:Homeodomain
Length: 303
Pfam Domains: 173-229 Homeobox domain
Sequence:
(in bold interface residues)
1 MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLP 60
61 FSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSV 120
121 GGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFT 180
181 TAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKM 240
241 AAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMY 300
301 HLT
Interface Residues: 171, 173, 174, 175, 176, 214, 215, 217, 218, 221, 222, 225, 226, 229
3D-footprint Homologues: 6fqp_B, 2h1k_B, 1puf_A, 6a8r_A, 3cmy_A, 3d1n_M, 1fjl_B, 5zfz_A, 1ig7_A, 6m3d_C, 2lkx_A, 1nk2_P, 1zq3_P, 6es3_K, 7q3o_C, 2ld5_A, 3a01_E, 5hod_A, 3lnq_A, 1jgg_B, 2hdd_A, 7psx_B, 5jlw_D, 3rkq_B, 2r5y_A, 1au7_A, 4xrs_G, 2hos_A, 4cyc_A, 1b72_A, 5flv_I, 5zjt_E, 4j19_B, 1e3o_C, 2xsd_C, 1le8_A, 7xrc_C, 1le8_B, 1du0_A, 8g87_X, 4qtr_D, 1mnm_C, 1puf_B, 1k61_B, 3l1p_A, 1o4x_A
Binding Motifs: MA0666.1 syAATTAv
M3576_1.02 ccgTawwTG
MA0666.2 syAATTAr
MA0666.3 yAATTA
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.