Transcription Factor
| Accessions: | TAL1_HUMAN (HOCOMOCO 10), P17542 (JASPAR 2024) |
| Names: | bHLHa17, Class A basic helix-loop-helix protein 17, Stem cell protein, T-cell acute lymphocytic leukemia protein 1, T-cell leukemia/lymphoma protein 5, TAL-1, TAL1_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 331 |
| Pfam Domains: | 188-239 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGP 60 61 GGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQ 120 121 LSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITD 180 181 GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA 240 241 KLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAAS 300 301 PDSYTEEPAPKHTARSLHPAMLPAADGAGPR |
| Interface Residues: | 189, 192, 193, 195, 196, 197, 199, 200, 225 |
| 3D-footprint Homologues: | 2ypa_A, 7z5k_B, 1am9_A, 6od3_F, 7d8t_A, 2ypa_B, 2ql2_A, 6g1l_A, 2ql2_D, 7ssa_L |
| Binding Motifs: | MA0140.2 cTTATCwskgagrarCAG TAL1_HUMAN.H10MO.A|M01547 ctkkkgsgsrswGATAAgr MA0091.1 mgAmCAKMTGkT MA0091.2 AmCAKMTGkT MA0140.3 TTATCwskgagrarCAG UN0808.1 GCACCTGg |
| Binding Sites: | UN0808.1.16 UN0808.1.19 / UN0808.1.4 UN0808.1.14 MA0091.1.1 MA0091.1.10 MA0091.1.11 MA0091.1.12 MA0091.1.13 MA0091.1.14 MA0091.1.15 MA0091.1.16 MA0091.1.17 MA0091.1.18 MA0091.1.19 MA0091.1.2 MA0091.1.20 MA0091.1.3 MA0091.1.4 MA0091.1.5 MA0091.1.6 MA0091.1.7 MA0091.1.8 MA0091.1.9 MA0140.2.1 MA0140.2.10 MA0140.2.11 MA0140.2.12 MA0140.2.13 MA0140.2.14 MA0140.2.15 MA0140.2.16 MA0140.2.17 MA0140.2.18 MA0140.2.19 MA0140.2.2 MA0140.2.20 MA0140.2.3 MA0140.2.4 MA0140.2.5 MA0140.2.6 MA0140.2.7 MA0140.2.8 MA0140.2.9 MA0091.2.19 / MA0091.2.20 MA0091.2.1 MA0091.2.10 MA0091.2.11 MA0091.2.12 MA0091.2.13 MA0091.2.14 MA0091.2.15 MA0091.2.16 MA0091.2.17 MA0091.2.18 MA0091.2.2 MA0091.2.3 MA0091.2.4 MA0091.2.5 MA0091.2.6 MA0091.2.7 MA0091.2.8 MA0091.2.9 MA0140.3.1 MA0140.3.10 MA0140.3.11 MA0140.3.12 MA0140.3.13 MA0140.3.14 MA0140.3.15 MA0140.3.16 MA0140.3.17 MA0140.3.18 MA0140.3.19 MA0140.3.2 MA0140.3.20 MA0140.3.3 MA0140.3.4 MA0140.3.5 MA0140.3.6 MA0140.3.7 MA0140.3.8 MA0140.3.9 UN0808.1.1 / UN0808.1.7 UN0808.1.10 / UN0808.1.12 / UN0808.1.15 / UN0808.1.20 UN0808.1.8 / UN0808.1.9 UN0808.1.11 UN0808.1.13 UN0808.1.17 UN0808.1.18 UN0808.1.2 UN0808.1.3 UN0808.1.5 UN0808.1.6 |
| Publications: | Hsu H.-L., Huang L., Tsan J. T., Funk W., Wright W. E., Hu J.-S., Kingston R. E., Baer R. Preferred sequences for DNA recognition by the TAL1 helix-loop-helix proteins. Mol. Cell. Biol. 14:1256-1265 (1994). [Pubmed] Kassouf M.T, Hughes J.R, Taylor S, McGowan S.J, Soneji S, Green A.L, Vyas P, Porcher C. Genome-wide identification of TAL1's functional targets: insights into its mechanisms of action in primary erythroid cells. Genome research 20:1064-83 (2010). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.