Transcription Factor

Accessions: phol (FlyZincFinger 1.0 )
Names: CG3445
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 128
Pfam Domains: 3-27 C2H2-type zinc finger
20-42 Zinc-finger double domain
32-54 C2H2-type zinc finger
32-54 Zinc finger, C2H2 type
47-72 Zinc-finger double domain
60-84 C2H2-type zinc finger
60-84 Zinc finger, C2H2 type
76-102 Zinc-finger double domain
90-114 C2H2-type zinc finger
90-114 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 PKFRCTHRGCNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPF 60
61 ECTFEGCGKRFSLDFNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTKPKRK 120
121 WPRAPQVS
Interface Residues: 16, 17, 18, 19, 21, 22, 23, 24, 25, 42, 43, 44, 45, 46, 48, 49, 51, 54, 68, 69, 70, 71, 72, 73, 74, 75, 76, 78, 79, 80, 83, 102, 103, 104, 105, 106, 107, 108, 109, 110
3D-footprint Homologues: 1tf6_A, 5k5l_F, 6ml4_A, 5v3j_F, 8gn3_A, 5yel_A, 5ei9_F, 6wmi_A, 7eyi_G, 2i13_A, 6e94_A, 7ysf_A, 2jpa_A, 1ubd_C, 7w1m_H, 8ssu_A, 5kkq_D, 8ssq_A, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 1tf3_A, 5und_A, 4x9j_A, 1mey_C, 6blw_A, 2drp_D, 6u9q_A, 2kmk_A, 7txc_E, 5kl3_A, 2gli_A, 5k5i_A, 8h9h_G, 7y3m_I, 2lt7_A, 6a57_A, 4gnx_Z, 3uk3_C, 1llm_D, 2wbs_A, 1f2i_J, 1g2f_F, 5yj3_D, 4m9v_C
Binding Motifs: phol_SANGER_5_FBgn0035997 MAAdATGGCG
phol_SOLEXA_5_FBgn0035997 ammAArATGGCGgmy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.