Transcription Factor

Accessions: A7RNB5 (JASPAR 2024)
Names: A7RNB5_NEMVE
Organisms: Nematostella vectensis
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: A7RNB5
Length: 156
Pfam Domains: 2-75 Pou domain - N-terminal to homeobox domain
94-150 Homeobox domain
Sequence:
(in bold interface residues)
1 MNPRELEWFAERFKQRRIKLGVTQADVGSALAHLKIPGVGSLSQSTICRFESLTLSHNNM 60
61 MALKPVLTAWLEEAEKAYKTKQCNSAFLPNSDKKRKRTSIGAAEKRSLEAYFAMNPRPSS 120
121 DKIASIAEKLDLSKNVVRVWFCNQRQKKKRMKFSVH
Interface Residues: 24, 25, 43, 44, 45, 46, 48, 49, 55, 59, 89, 90, 91, 92, 93, 94, 95, 96, 97, 135, 136, 138, 139, 142, 143, 146, 147, 150
3D-footprint Homologues: 3l1p_A, 7u0g_M, 3cro_R, 3d1n_M, 1o4x_A, 8g87_X, 1e3o_C, 7xrc_C, 2xsd_C, 1au7_A, 1mey_C, 3a01_E, 1ig7_A, 1puf_A, 6a8r_A, 3cmy_A, 2h1k_B, 1nk2_P, 1fjl_B, 5zfz_A, 2lkx_A, 3lnq_A, 1zq3_P, 2ld5_A, 5zjt_E, 2d5v_B, 1b72_A, 5hod_A, 2r5y_A, 1puf_B, 2hdd_A, 7psx_B, 5jlw_D, 7q3o_C, 1le8_A, 4cyc_A, 1jgg_B, 4qtr_D, 1mnm_C, 1k61_B, 6es3_K, 4xrs_G, 3rkq_B, 5flv_I
Binding Motifs: UN0273.1 hTAATTAATd
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.