Transcription Factor

Accessions: MEF2C_HUMAN (HOCOMOCO 10), Q06413 (JASPAR 2018)
Names: MEF2C_HUMAN, Myocyte enhancer factor 2C, Myocyte-specific enhancer factor 2C
Organisms: Homo sapiens
Libraries: HOCOMOCO 10 1, JASPAR 2018 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
2 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
Length: 473
Pfam Domains: 10-59 SRF-type transcription factor (DNA-binding and dimerisation domain)
95-155 Holliday junction regulator protein family C-terminal repeat
Sequence:
(in bold interface residues)
1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST 60
61 DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI 120
121 NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN 180
181 SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS 240
241 PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT 300
301 PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP 360
361 SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP 420
421 VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
Interface Residues: 3, 4, 15, 18, 19, 23
3D-footprint Homologues: 1hbx_D, 1n6j_A, 1egw_B, 3p57_C, 1mnm_A
Binding Motifs: MEF2C_HUMAN.H10MO.C|M01321 dkCTATTTTTrgm
MA0497.1 rdkcyAAAAATAGmw
Binding Sites: MA0497.1.1
MA0497.1.10
MA0497.1.11
MA0497.1.12
MA0497.1.13
MA0497.1.14
MA0497.1.15
MA0497.1.16
MA0497.1.17
MA0497.1.18
MA0497.1.19
MA0497.1.2
MA0497.1.20
MA0497.1.3
MA0497.1.4
MA0497.1.5
MA0497.1.6
MA0497.1.7
MA0497.1.8
MA0497.1.9
Publications: Andres V., Cervera M., Mahdavi V. Determination of the consensus binding site for MEF2 expressed in muscle and brain reveals tissue-specific sequence constraints. J. Biol. Chem. 270:23246-23249 (1995). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.