Transcription Factor

Accessions: ATF6 (HT-SELEX2 May2017)
Names: ATF6, ENSG00000118217
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 102
Pfam Domains: 20-79 bZIP transcription factor
21-71 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 VTKPVLQSTMRNVGSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQ 60
61 LKKENGTLKRQLDEVVSENQRLKVPSPKRRVVCVMIVLAFII
Interface Residues: 3, 4, 6, 7, 10, 11, 25, 29, 30, 32, 33, 36, 37
3D-footprint Homologues: 5i50_B, 7x5e_F, 7x5e_E, 2dgc_A, 5t01_B, 1dh3_C
Binding Motifs: ATF6_3 grTGACGTCAyc
ATF6_4 tgrTGACGTGGCAs
ATF6_methyl_1 grTGACGTCAyc
ATF6_methyl_2 tgrTGACGTGGCrk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.