Transcription Factor
| Accessions: | T061562_1.02 (CISBP 1.02), Q03081 (JASPAR 2024) |
| Names: | MET31, T061562_1.02;, MET31_YEAST, Methionine-requiring protein 31, Transcriptional regulator MET31 |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:C2H2 ZF |
| Length: | 177 |
| Pfam Domains: | 95-117 C2H2-type zinc finger 95-117 Zinc finger, C2H2 type 109-133 Zinc-finger double domain 123-141 C2H2-type zinc finger 123-144 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MKLAQDMNVDEIFLKQAAEAIAVISSSPTHTDPIIRELLHRIRQSSPLSAVIPAPENVLK 60 61 AGEPENMARGLIRIPETQTKRTGGNNHSKEGAQLYSCAKCQLKFSRSSDLRRHEKVHSLV 120 121 LPHICSNCGKGFARKDALKRHSNTLTCQRNRKKLSEGSDVDVDELIKDAIKNGTGLL |
| Interface Residues: | 105, 106, 107, 108, 109, 110, 111, 112, 113, 115, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 144, 156, 158, 159, 162, 163, 164, 165 |
| 3D-footprint Homologues: | 8cuc_F, 2kmk_A, 1tf3_A, 7y3l_A, 1g2f_F, 5kl3_A, 1tf6_A, 6u9q_A, 5yj3_D, 5ei9_F, 2i13_A, 8h9h_G, 1llm_D, 5und_A, 2wbs_A, 1ubd_C, 6wmi_A, 6a57_A, 5k5i_A, 2jpa_A, 8ssq_A, 1mey_C, 7w1m_H, 6jnm_A, 2drp_D, 1f2i_J, 6blw_A, 5kkq_D, 6ml4_A, 5yel_A, 4x9j_A, 8gn3_A, 7n5w_A, 5v3j_F, 4m9v_C, 2gli_A, 2lt7_A, 7y3m_I, 6e94_A, 7ysf_A, 7eyi_G, 7txc_E, 6dnw_A |
| Binding Motifs: | M0537_1.02 rGAGGTGkrs MA0333.1 rstGTGGCG MA0333.2 GTGGCG |
| Publications: | Badis G, Chan E.T, van Bakel H, Pena-Castillo L, Tillo D, Tsui K, Carlson C.D, Gossett A.J, Hasinoff M.J, Warren C.L, Gebbia M, Talukder S, Yang A, Mnaimneh S, Terterov D, Coburn D, Li Yeo A, Yeo Z.X, Clarke N.D, Lieb J.D, Ansari A.Z, Nislow C, Hughes T.R. A library of yeast transcription factor motifs reveals a widespread function for Rsc3 in targeting nucleosome exclusion at promoters. Molecular cell 32:878-87 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.