Transcription Factor

Accessions: AHL20 (ArabidopsisPBM 20140210), Q8GWQ2 (JASPAR 2018)
Names: AHL20, AHL20_ARATH
Organisms: Arabidopsis thaliana
Libraries: ArabidopsisPBM 20140210 1, JASPAR 2018 2
1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed]
2 [Pubmed]
Notes: AT-Hook
Length: 281
Pfam Domains: 95-211 Domain of unknown function (DUF296)
Sequence: MANPWWTNQSGLAGMVDHSVSSGHHQNHHHQSLLTKGDLGIAMNQSQDNDQDEEDDPREG
AVEVVNRRPRGRPPGSKNKPKAPIFVTRDSPNALRSHVLEISDGSDVADTIAHFSRRRQR
GVCVLSGTGSVANVTLRQAAAPGGVVSLQGRFEILSLTGAFLPGPSPPGSTGLTVYLAGV
QGQVVGGSVVGPLLAIGSVMVIAATFSNATYERLPMEEEEDGGGSRQIHGGGDSPPRIGS
NLPDLSGMAGPGYNMPPHLIPNGAGQLGHEPYTWVHARPPY
Binding Motifs: AHL20 wAATATATTw
AHL20_2 hAATTAAwTa
AHL20_3 tAwwWWwwTa
MA0933.1 AATWAAwT
Publications: Yun J, Kim YS, Jung JH, Seo PJ, Park CM. The AT-hook motif-containing protein AHL22 regulates flowering initiation by modifying FLOWERING LOCUS T chromatin in Arabidopsis. J Biol Chem 287:15307-16 (2012). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.