Transcription Factor
Accessions: | 1ngm_E (3D-footprint 20231221), 1nh2_A (3D-footprint 20231221), 1rm1_A (3D-footprint 20231221), 1ytb_A (3D-footprint 20231221), 1ytf_A (3D-footprint 20231221), 6f41_U (3D-footprint 20231221) |
Names: | TATA sequence-binding protein, TATA-binding factor, TATA-box factor, TATA-box-binding protein, TBP_YEAST, Transcription factor D, Transcription initiation factor TFIID, Transcription initiation factor TFIID TBP subunit, TATA-box binding protein, TATA BINDING PROTEIN (TBP) |
Organisms: | Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P13393 |
Length: | 180 |
Pfam Domains: | 5-87 Transcription factor TFIID (or TATA-binding protein, TBP) 92-178 Transcription factor TFIID (or TATA-binding protein, TBP) |
Sequence: (in bold interface residues) | 1 SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGK 60 61 MVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHG 120 121 TFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 180 |
Interface Residues: | 9, 11, 39, 40, 54, 56, 62, 64, 98, 99, 101, 130, 131, 145, 147, 153, 155 |
3D-footprint Homologues: | 6cnb_R, 1cdw_A, 5iy6_P, 7z7n_D, 1qna_B, 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D |
Binding Motifs: | 1ngm_E TAtAAaA 1nh2_AC TAnAAaAc 1rm1_A gTtTTATA 1rm1_AC gTtTTATA 1ytb_A GTAtATAAnnCG 1ytf_AC TATATAAAAC 6f41_U AntTnTa |
Binding Sites: | 1ngm_G 1ngm_H 1nh2_F / 1ytf_F 1rm1_D 1rm1_E 1ytf_E 1ytb_C 1nh2_E 6f41_X 6f41_Y |
Publications: | Juo Z.S, Kassavetis G.A, Wang J, Geiduschek E.P, Sigler P.B. Crystal structure of a transcription factor IIIB core interface ternary complex. Nature 422:534-9 (2003). [Pubmed] Bleichenbacher M, Tan S, Richmond T.J. Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes. Journal of molecular biology 332:783-93 (2003). [Pubmed] Kim Y, Geiger J.H, Hahn S, Sigler P.B. Crystal structure of a yeast TBP/TATA-box complex. Nature 365:512-20 (1993). [Pubmed] Tan S., Hunziker Y., Sargent D. F., Richmond T. J. Crystal structure of a yeast TFIIA/TBP/DNA complex. Nature 381:127-134 (1996). [Pubmed] Vorländer MK, Khatter H, Wetzel R, Hagen WJH, Müller CW. Molecular mechanism of promoter opening by RNA polymerase III. Nature 553:295-300 (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.