Transcription Factor

Accessions: MEOX1 (HT-SELEX2 May2017), P50221 (JASPAR 2024)
Names: ENSG00000005102, MEOX1, Homeobox protein MOX-1, MEOX1_HUMAN, Mesenchyme homeobox 1
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1, JASPAR 2024 2
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 254
Pfam Domains: 172-228 Homeobox domain
Sequence:
(in bold interface residues)
1 MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYP 60
61 DFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSS 120
121 LGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTK 180
181 EQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQ 240
241 DPEDGDSTASPSSE
Interface Residues: 172, 173, 174, 175, 176, 213, 214, 216, 217, 220, 221, 224, 225, 228
3D-footprint Homologues: 3d1n_M, 5zfz_A, 1fjl_B, 2h1k_B, 1puf_A, 1ig7_A, 6a8r_A, 3cmy_A, 1jgg_B, 1nk2_P, 1zq3_P, 6m3d_C, 3lnq_A, 2lkx_A, 6es3_K, 2ld5_A, 7q3o_C, 1puf_B, 4xrs_G, 2hos_A, 4cyc_A, 5flv_I, 5zjt_E, 4j19_B, 3a01_E, 7psx_B, 1b72_A, 5hod_A, 2hdd_A, 5jlw_D, 3rkq_B, 2r5y_A, 3l1p_A, 7xrc_C, 1e3o_C, 2xsd_C, 1au7_A, 1le8_A, 1k61_B, 1o4x_A, 8g87_X, 4qtr_D, 1mnm_C, 1du0_A
Binding Motifs: MA0661.1 rsTAATTAmc
MEOX1_3 gymATtAs
MEOX1_4 vkCrTtAw
MEOX1_methyl_1 gymATTAs
MEOX1_methyl_2 rtCrTTAr
MA0661.2 sTAATTA
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.