Transcription Factor

Accessions: Q9AT76 (JASPAR 2018)
Names: Agamous-like MADS-box protein AGL27, AGL27_ARATH, MADS box FLC1-like nuclear protein, Protein FLOWERING LOCUS M, Protein MADS AFFECTING FLOWERING 1
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2018 1
1 [Pubmed]
Uniprot: Q9AT76
Length: 196
Pfam Domains: 9-56 SRF-type transcription factor (DNA-binding and dimerisation domain)
95-164 K-box region
Sequence:
(in bold interface residues)
1 MGRRKIEIKRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYDSSSG 60
61 DDISKIIDRYEIQHADELRALDLEEKIQNYLPHKELLETVQSKLEEPNVDNVSVDSLISL 120
121 EEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQMGKNTLLATDDERGMFP 180
181 GSSSGNKIPETLPLLN
Interface Residues: 3, 4, 15, 18, 19, 23
3D-footprint Homologues: 1n6j_A, 1egw_B, 1hbx_D, 1mnm_A
Binding Motifs: MA1012.1 cTTTCyATTTTkGk
Binding Sites: MA1012.1.1
MA1012.1.10
MA1012.1.11
MA1012.1.12
MA1012.1.13
MA1012.1.14
MA1012.1.15
MA1012.1.16
MA1012.1.17
MA1012.1.18
MA1012.1.19
MA1012.1.2
MA1012.1.20
MA1012.1.3
MA1012.1.4
MA1012.1.5
MA1012.1.6
MA1012.1.7
MA1012.1.8
MA1012.1.9
Publications: Posé D, Verhage L, Ott F, Yant L, Mathieu J, Angenent GC, Immink RG, Schmid M. Temperature-dependent regulation of flowering by antagonistic FLM variants. Nature 503:414-7 (2013). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.