Transcription Factor
| Accessions: | SIX2 (HT-SELEX2 May2017), Q9NPC8 (JASPAR 2024) |
| Names: | ENSG00000170577, SIX2, Homeobox protein SIX2, Sine oculis homeobox homolog 2, SIX2_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 291 |
| Pfam Domains: | 130-180 Homeobox domain 145-178 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 MSMLPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHR 60 61 GNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRS 120 121 IWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR 180 181 AAEAKERENNENSNSNSHNPLNGSGKSVLGSSEDEKTPSGTPDHSSSSPALLLSPPPPGL 240 241 PSLHSLGHPPGPSAVPVPVPGGGGADPLQHHHGLQDSILNPMSANLVDLGS |
| Interface Residues: | 119, 128, 166, 167, 169, 170, 173, 174, 177, 178, 180, 181 |
| 3D-footprint Homologues: | 4xrs_G, 4j19_B, 2ld5_A, 5jlw_D, 1e3o_C, 7q3o_C, 1au7_A, 7xrc_C, 1le8_A, 1ig7_A, 2xsd_C, 1le8_B, 6es3_K, 1du0_A, 3l1p_A, 1puf_A, 7psx_B, 1jgg_B, 5zfz_A, 3a01_E, 2h1k_B, 1mnm_C, 6fqp_B, 5flv_I, 3lnq_A, 2lkx_A, 1puf_B, 1k61_B, 5zjt_E, 4qtr_D, 3cmy_A, 2hdd_A, 1nk2_P, 6fqq_E, 1fjl_B, 5hod_A, 3rkq_B, 2r5y_A, 1zq3_P, 6a8r_A, 1b72_A, 4xrm_B, 3d1n_M, 1o4x_A, 4cyc_A, 2d5v_B, 8g87_X, 2hos_A, 6m3d_C |
| Binding Motifs: | SIX2_2 mcGTATCrys SIX2_4 mcGTrtCryc SIX2_methyl_1 rsrTATCryb SIX2_methyl_3 vsrTAwCryr MA1119.1 wwcTGaAACCTGAtmy MA1119.2 TGaAACCTGAt |
| Binding Sites: | MA1119.1.1 MA1119.1.10 MA1119.1.11 MA1119.1.12 MA1119.1.13 MA1119.1.14 MA1119.1.15 MA1119.1.16 MA1119.1.17 MA1119.1.18 MA1119.1.19 MA1119.1.2 MA1119.1.20 MA1119.1.3 MA1119.1.4 MA1119.1.5 MA1119.1.6 MA1119.1.7 MA1119.1.8 MA1119.1.9 MA1119.2.1 MA1119.2.10 MA1119.2.11 / MA1119.2.15 MA1119.2.12 MA1119.2.13 MA1119.2.14 MA1119.2.16 MA1119.2.17 MA1119.2.18 MA1119.2.19 MA1119.2.2 MA1119.2.20 MA1119.2.3 MA1119.2.4 MA1119.2.5 MA1119.2.6 MA1119.2.7 MA1119.2.8 MA1119.2.9 |
| Publications: | Brodbeck S, Besenbeck B, Englert C. The transcription factor Six2 activates expression of the Gdnf gene as well as its own promoter. Mech Dev 121:1211-22 (2004). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.