Transcription Factor
| Accessions: | P0CY11 (JASPAR 2024) |
| Names: | HMRA1_YEAST, MATa1 protein, Silenced mating-type protein A1 |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P0CY11 |
| Length: | 126 |
| Pfam Domains: | 73-126 Homeobox domain 98-124 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 MDDICSMAENINRTLFNILGTEIDEINLNTNNLYNFIMESNLTKVEQHTLHKNISNNRLE 60 61 IYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFIN 120 121 KRMRSK |
| Interface Residues: | 38, 39, 40, 43, 44, 50, 53, 66, 69, 74, 112, 115, 116, 119, 120, 123, 124 |
| 3D-footprint Homologues: | 7xrc_C, 8g87_X, 1puf_A, 3l1p_A, 2hdd_A, 5zfz_A, 2hos_A, 1au7_A, 6a8r_A, 3d1n_M, 5jlw_D, 4j19_B, 1ig7_A, 1e3o_C, 1le8_A, 7q3o_C, 2r5y_A, 1puf_B, 6es3_K, 4xrs_G, 1nk2_P, 1du0_A, 3a01_E, 1zq3_P, 6fqp_B, 5flv_I, 3lnq_A, 1o4x_A, 5zjt_E, 4qtr_D, 3cmy_A, 2h1k_B, 1jgg_B, 6fqq_E, 5hod_A, 3rkq_B, 2lkx_A, 1fjl_B, 4xrm_B, 1b72_A, 4cyc_A, 1ic8_B, 2h8r_B |
| Binding Motifs: | MA0327.1 rCACAAT |
| Publications: | MacIsaac K.D, Wang T, Gordon D.B, Gifford D.K, Stormo G.D, Fraenkel E. An improved map of conserved regulatory sites for Saccharomyces cerevisiae. BMC bioinformatics 7:113 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.