Transcription Factor
Accessions: | ZNF675 (humanC2H2ZF-ChIP Feb2015), Q8TD23 (JASPAR 2024) |
Names: | ENSG00000197372, Q8TD23, ZNF675, TRAF6-binding zinc finger protein, TRAF6-inhibitory zinc finger protein, Zinc finger protein 675, ZN675_HUMAN |
Organisms: | Homo sapiens |
Libraries: | humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2 1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Notes: | TF family: C2H2;KRAB experiment: ChIP-seq/MEME/B1H-RC |
Length: | 568 |
Pfam Domains: | 4-44 KRAB box 160-181 Zinc-finger double domain 172-192 Zinc finger, C2H2 type 172-194 C2H2-type zinc finger 215-238 Zinc-finger double domain 227-244 C2H2-type zinc finger 249-266 Zinc-finger double domain 255-275 C2H2-type zinc finger 256-278 Zinc finger, C2H2 type 256-278 C2H2-type zinc finger 270-294 Zinc-finger double domain 283-304 C2H2-type zinc finger 284-306 Zinc finger, C2H2 type 284-306 C2H2-type zinc finger 298-323 Zinc-finger double domain 312-332 C2H2-type zinc finger 312-334 Zinc finger, C2H2 type 312-334 C2H2-type zinc finger 327-350 Zinc-finger double domain 339-359 C2H2-type zinc finger 340-362 Zinc finger, C2H2 type 340-360 C2H2-type zinc finger 355-378 Zinc-finger double domain 367-388 C2H2-type zinc finger 368-390 Zinc finger, C2H2 type 368-390 C2H2-type zinc finger 382-407 Zinc-finger double domain 395-416 C2H2-type zinc finger 396-418 Zinc finger, C2H2 type 396-418 C2H2-type zinc finger 410-434 Zinc-finger double domain 423-446 C2H2-type zinc finger 424-446 C2H2-type zinc finger 424-446 Zinc finger, C2H2 type 439-461 Zinc-finger double domain 451-472 C2H2-type zinc finger 452-474 Zinc finger, C2H2 type 467-491 Zinc-finger double domain 479-500 C2H2-type zinc finger 480-502 C2H2-type zinc finger 480-502 Zinc finger, C2H2 type 494-519 Zinc-finger double domain 507-527 C2H2-type zinc finger 508-530 C2H2-type zinc finger 508-530 Zinc finger, C2H2 type 523-546 Zinc-finger double domain 535-556 C2H2-type zinc finger 536-558 C2H2-type zinc finger 536-558 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEK 60 61 EPLTVKRHEMVNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVD 120 121 ECKLHKGGYNGLNQCLPTMQSKMFQCDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRS 180 181 FCMLSHLTRHERNYTKVNFCKCEECEKAVNQSSKLTKHKRIYTCEKLYKCQECDRTFNQF 240 241 SNLTEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLT 300 301 THKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKN 360 361 IHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG 420 421 EKPYKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPY 480 481 KCEECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCER 540 541 CDKAFNQSANLTKHKKIHTGEKLQNWNV |
Interface Residues: | 239, 241, 245, 256, 266, 267, 268, 269, 270, 273, 277, 294, 295, 296, 297, 298, 300, 301, 303, 304, 305, 307, 322, 323, 324, 325, 326, 328, 329, 350, 351, 352, 353, 354, 356, 357, 378, 379, 380, 381, 382, 385, 387, 406, 407, 408, 409, 410, 413, 414, 416, 434, 435, 436, 437, 438, 439, 440, 441, 442, 445, 447, 461, 462, 463, 464, 465, 466, 469, 473, 490, 491, 492, 493, 494, 496, 497, 519, 520, 521, 522, 524, 525, 546, 547, 549, 550, 553 |
3D-footprint Homologues: | 7w1m_H, 2kmk_A, 6wmi_A, 8ssq_A, 8ssu_A, 2i13_A, 5ei9_F, 6e94_A, 5k5i_A, 1g2f_F, 6ml4_A, 1mey_C, 5kl3_A, 7y3m_I, 2jpa_A, 1tf6_A, 5v3j_F, 7txc_E, 2lt7_A, 5yel_A, 7n5w_A, 1f2i_J, 5yj3_D, 2wbs_A, 7eyi_G, 6jnm_A, 4x9j_A, 7ysf_A, 6a57_A, 8cuc_F, 7y3l_A, 5und_A, 2gli_A, 1llm_D, 6blw_A, 4m9v_C, 8h9h_G, 5kkq_D, 1ubd_C, 1tf3_A, 3uk3_C, 2drp_D, 8gn3_A, 6u9q_A, 5k5l_F |
Binding Motifs: | ZNF675_ChIP GGATTArGAGGACA UN0212.1 GraAAAATGgTTT MA1714.1 rgGmyyarGAGGmcAaAATGw MA1714.2 gGmyyarGAGGmcAaAATG |
Binding Sites: | UN0212.1.1 UN0212.1.10 UN0212.1.11 UN0212.1.12 UN0212.1.13 UN0212.1.14 UN0212.1.15 UN0212.1.16 UN0212.1.17 UN0212.1.18 UN0212.1.19 UN0212.1.2 UN0212.1.20 UN0212.1.3 UN0212.1.4 UN0212.1.5 UN0212.1.6 UN0212.1.7 UN0212.1.8 UN0212.1.9 |
Publications: | Dinh DT, Breen J, Akison LK, DeMayo FJ, Brown HM, Robker RL, Russell DL. Tissue-specific progesterone receptor-chromatin binding and the regulation of progesterone-dependent gene expression. Sci Rep 9:11966 (2019). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.