Transcription Factor
Accessions: | GATA1_TF1 (HumanTF2 1.0), GATA1 (HT-SELEX2 May2017) |
Names: | Eryf1, Erythroid transcription factor, GATA-1, GATA-binding factor 1, GATA1, GATA1_HUMAN, GF-1, NF-E1 DNA-binding protein, ENSG00000102145 |
Organisms: | Homo sapiens |
Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | P15976 |
Notes: | Ensembl ID: ENSG00000102145; Construct type: TF1(SBP); TF family: znfGATA; Clone source: Megaman, TF family: Znf_GATA experiment: HT-SELEX Hamming distance: 1 cycle: 4b0, TF family: Znf_GATA experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4b0 |
Length: | 143 |
Pfam Domains: | 25-58 GATA zinc finger 79-112 GATA zinc finger |
Sequence: (in bold interface residues) | 1 LNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNR 60 61 PLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRK 120 121 DGIQTRNRKASGKGKKKRGSSLG |
Interface Residues: | 34, 35, 37, 47, 51, 88, 89, 91, 101, 105, 106, 109, 126, 128, 129 |
3D-footprint Homologues: | 4hc9_A, 3vd6_C, 1gat_A, 3dfx_B, 4gat_A |
Binding Motifs: | GATA1 hGATAAs GATA1_2 GATAAkrrcmTTATC GATA1_methyl_1 GATAAkrwymTTATC |
Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.