Transcription Factor
Accessions: | CDX4 (HT-SELEX2 May2017), O14627 (JASPAR 2024) |
Names: | CDX4, ENSG00000131264, Caudal-type homeobox protein 4, CDX4_HUMAN, Homeobox protein CDX-4 |
Organisms: | Homo sapiens |
Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
Length: | 284 |
Pfam Domains: | 13-171 Caudal like protein activation region 175-230 Homeobox domain |
Sequence: (in bold interface residues) | 1 MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMP 60 61 SMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVG 120 121 GGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVY 180 181 TDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFE 240 241 NSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE |
Interface Residues: | 171, 174, 175, 176, 177, 215, 216, 218, 219, 222, 223, 226, 227, 229, 230 |
3D-footprint Homologues: | 3l1p_A, 2h1k_B, 1puf_A, 3cmy_A, 3d1n_M, 1fjl_B, 3lnq_A, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 2ld5_A, 6es3_K, 7q3o_C, 1ig7_A, 5zjt_E, 3a01_E, 6a8r_A, 2hdd_A, 7psx_B, 5jlw_D, 3rkq_B, 2r5y_A, 4xrs_G, 2hos_A, 5zfz_A, 4cyc_A, 6m3d_C, 1b72_A, 5flv_I, 7xrc_C, 1e3o_C, 1au7_A, 2xsd_C, 1le8_A, 1o4x_A, 4qtr_D, 1le8_B, 6wig_A, 1du0_A, 5hod_A, 8g87_X, 4xrm_B, 1mnm_C, 1puf_B, 1k61_B |
Binding Motifs: | CDX4_3 / MA1473.1 gGymATAAAac CDX4_methyl_1 sGTCGTAAAas CDX4_methyl_2 kGCmATAAAac MA1473.2 GymATAAAa |
Publications: | Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.