Transcription Factor

Accessions: 4kdp_A (3D-footprint 20231221), 4kdp_B (3D-footprint 20231221)
Names: A0A0H2VJZ8_STAES, TcaR transcription regulator
Organisms: Staphylococcus epidermidis, strain ATCC 12228 / FDA PCI 1200
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8CN94
Length: 151
Pfam Domains: 34-93 MarR family
37-103 Winged helix DNA-binding domain
37-93 MarR family
42-82 Bacterial regulatory protein, arsR family
Sequence:
(in bold interface residues)
1 MVRRIEDHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSIEALTVGQITEK 60
61 QGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASD 120
121 MTSDFDSKEIEKVRQVLEIIDYRIQSYTSKL
Interface Residues: 37, 39, 43, 47, 64, 65, 66, 67, 69, 70, 71, 74, 93
3D-footprint Homologues: 4kdp_B, 7yho_A, 5yi2_J, 3q5f_A, 7dvv_A
Binding Motifs: 4kdp_AB CGCAGcGnnnA
4kdp_B CncAg
Binding Sites: 4kdp_H
Publications: Chang Y.M, Ho C.H, Chen C.K, Maestre-Reyna M, Chang-Chien M.W, Wang A.H. TcaR-ssDNA complex crystal structure reveals new DNA binding mechanism of the MarR family proteins. Nucleic acids research 42:5314-21 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.