Transcription Factor
| Accessions: | FOXA1_TF1 (HumanTF2 1.0), FOXA1 (HT-SELEX2 May2017) |
| Names: | Forkhead box protein A1, FOXA1, FOXA1_HUMAN, Hepatocyte nuclear factor 3-alpha, HNF-3-alpha, HNF-3A, TCF-3A, Transcription factor 3A, ENSG00000129514 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P55317 |
| Notes: | Ensembl ID: ENSG00000129514; Construct type: TF1(SBP); TF family: Forkhead; Clone source: Gene synthesis, TF family: Forkhead experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Forkhead experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4, TF family: Forkhead experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 138 |
| Pfam Domains: | 23-118 Fork head domain |
| Sequence: (in bold interface residues) | 1 LGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQRAPSKMLTLSEIYQWIMDLFPYY 60 61 RQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFK 120 121 CEKQPGAGGGGGSGSGGS |
| Interface Residues: | 18, 20, 63, 66, 68, 69, 70, 72, 73, 74, 76, 77, 86, 93, 118 |
| 3D-footprint Homologues: | 7yzb_A, 3l2c_A, 7vox_H, 2hdc_A, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 6nce_A, 2uzk_A, 7vou_C, 3qrf_G |
| Binding Motifs: | FOXA1 wrwGYMMAyA FOXA1_2 ywrtGTAMAyAa FOXA1_5 csyTAwGTAAACAAAs FOXA1_6 yWrwGTmAATATTTrCwywr FOXA1_methyl_1 ywrwGymAAyAw FOXA1_methyl_3 csyTAwGTAAACAAac FOXA1_methyl_4 yTrwGTAAATATTTrYwyAr |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.