Transcription Factor

						

			
Accessions: 3wtv_A (3D-footprint 20231221), 3wtv_F (3D-footprint 20231221)

			
Names: Acute myeloid leukemia 1 protein, CBF-alpha-2, Core-binding factor subunit alpha-2, Oncogene AML-1, PEA2-alpha B, PEBP2-alpha B, Polyomavirus enhancer-binding protein 2 alpha B subunit, Runt-related transcription factor 1, RUNX1_MOUSE, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q03347
Length: 118
Pfam Domains:     1-118 Runt domain
Sequence: 
(in bold interface residues)		   1 GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRN   60
  61 ATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITGDGPREPR
Interface Residues: 21, 83, 111, 112, 115, 118
3D-footprint Homologues: 4l18_E, 6vg8_D, 3wts_A, 6vgd_D, 4l0y_A
Binding Motifs: 3wtv_AC AGGATGTGGC
3wtv_F agCCACA
Binding Sites: 3wtv_I
3wtv_J
			
Publications: Shiina M, Hamada K, Inoue-Bungo T, Shimamura M, Uchiyama A, Baba S, Sato K, Yamamoto M, Ogata K. A Novel Allosteric Mechanism on Protein-DNA Interactions underlying the Phosphorylation-Dependent Regulation of Ets1 Target Gene Expressions. Journal of molecular biology 427:1655-69 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.