Transcription Factor
| Accessions: | EHF_full (HumanTF 1.0), EHF_HUMAN (HOCOMOCO 10), Q9NZC4 (JASPAR 2024) |
| Names: | EHF, EHF_HUMAN, Epithelium-specific Ets transcription factor 3, ESE-3, ETS domain-containing transcription factor, ETS homologous factor, hEHF |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9NZC4 |
| Notes: | Ensembl ID: ENSG00000135373; Full protein sequence; TF family: ETS; Clone source: Megaman |
| Length: | 300 |
| Pfam Domains: | 39-114 Sterile alpha motif (SAM)/Pointed domain 207-290 Ets-domain |
| Sequence: (in bold interface residues) | 1 MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQ 60 61 HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSD 120 121 LFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLP 180 181 VAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFL 240 241 KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN 300 |
| Interface Residues: | 261, 262, 264, 265, 266, 268, 269, 283 |
| 3D-footprint Homologues: | 4uno_A, 3jtg_A, 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A |
| Binding Motifs: | EHF_full / MA0598.2 wACCCGGAAGTa EHF_HUMAN.H10MO.C|M01100 rrArvAGGAArtrrrrr MA0598.1 mCTTCCTs MA0598.3 sycACTTCCTgttty MA0598.4 cACTTCCTg |
| Binding Sites: | MA0598.1.1 MA0598.1.10 MA0598.1.11 MA0598.1.12 MA0598.1.13 MA0598.1.14 MA0598.1.15 MA0598.1.16 MA0598.1.17 MA0598.1.18 MA0598.1.19 MA0598.1.2 MA0598.1.20 MA0598.1.3 MA0598.1.4 MA0598.1.5 MA0598.1.6 MA0598.1.7 MA0598.1.8 MA0598.1.9 MA0598.3.1 MA0598.3.10 / MA0598.3.5 MA0598.3.11 / MA0598.3.6 MA0598.3.12 / MA0598.3.7 MA0598.3.13 / MA0598.3.8 MA0598.3.10 / MA0598.3.14 MA0598.3.11 / MA0598.3.15 MA0598.3.12 / MA0598.3.16 MA0598.3.13 / MA0598.3.17 MA0598.3.18 MA0598.3.19 MA0598.3.2 MA0598.3.20 MA0598.3.3 MA0598.3.4 MA0598.3.1 / MA0598.3.5 MA0598.3.6 MA0598.3.2 / MA0598.3.7 MA0598.3.3 / MA0598.3.8 MA0598.3.4 / MA0598.3.9 MA0598.3.14 MA0598.3.15 MA0598.3.16 MA0598.3.17 MA0598.3.18 MA0598.3.19 MA0598.3.20 MA0598.3.9 MA0598.4.1 MA0598.4.10 / MA0598.4.17 MA0598.4.11 / MA0598.4.12 / MA0598.4.13 MA0598.4.14 MA0598.4.15 MA0598.4.16 MA0598.4.18 MA0598.4.19 MA0598.4.2 / MA0598.4.3 / MA0598.4.4 MA0598.4.20 MA0598.4.5 MA0598.4.6 MA0598.4.7 MA0598.4.8 MA0598.4.9 |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] tugores A., Le J., Sorokina I., Snijders A. J., Duyao M., Reddy P. S., Carlee L., Ronshaugen M., Mushegian A., Watanaskul T., Chu S., Buckler A., Emtage S., McCormick M. K. The epithelium-specific ETS protein EHF/ESE-3 is a context-dependent transcriptional repressor downstream of MAPK signaling cascades.. J. Biol. Chem. 276:20397-20406 (2001). [Pubmed] Jolma A., Kivioja T., Toivonen J., Cheng L., Wei G., Enge M., Taipale M., Vaquerizas J. M., Yan J., Sillanpaa M. J., Bonke M., Palin K., Talukder S., Hughes T. R., Luscombe N. M., Ukkonen E., Taipale J. Multiplexed massively parallel SELEX for characterization of human transcription factor binding specificities.. Genome Res. 20:861-873 (2010). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.