Transcription Factor
| Accessions: | Tcf21_DBD (HumanTF 1.0), T015219_1.02 (CISBP 1.02), O35437 (JASPAR 2024) |
| Names: | Capsulin, Epicardin, Pod-1, Podocyte-expressed 1, TCF-21, Tcf21, TCF21_MOUSE, Transcription factor 21, T015219_1.02; |
| Organisms: | Mus musculus |
| Libraries: | HumanTF 1.0 1, CISBP 1.02 2, JASPAR 2024 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | O35437 |
| Notes: | Ensembl ID: ENSMUSG00000045680; DNA-binding domain sequence; TF family: bHLH; Clone source: Hughes lab., experiment type:PBM, family:bHLH |
| Length: | 179 |
| Pfam Domains: | 80-132 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MSTGSLSDVEDLQEVEMLDCDSLKVDSNKEFGTSNESTEEGSNCENGSPQKGRGGLGKRR 60 61 KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT 120 121 LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPENDLKEVVTANRLCGTTAS |
| Interface Residues: | 81, 84, 85, 87, 88, 89, 90, 91, 92 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 6od3_F, 2ypa_B, 2ql2_A, 2ql2_D, 5nj8_C, 5v0l_B |
| Binding Motifs: | MA0832.1 / Tcf21_DBD ryAACAGCTGTTry M0214_1.02 RMCAkmTGk MA0832.2 AACAGCTGTT |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Sazonova O, Zhao Y, Nürnberg S, Miller C, Pjanic M, Castano VG, Kim JB, Salfati EL, Kundaje AB, Bejerano G, Assimes T, Yang X, Quertermous T. Characterization of TCF21 Downstream Target Regions Identifies a Transcriptional Network Linking Multiple Independent Coronary Artery Disease Loci. PLoS Genet : (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.