Transcription Factor
| Accessions: | 1je8_A (3D-footprint 20231221), 1je8_B (3D-footprint 20231221), 1je8_F (3D-footprint 20231221), 1zg1_A (3D-footprint 20231221), 1zg1_B (3D-footprint 20231221), 1zg1_E (3D-footprint 20231221), 1zg1_F (3D-footprint 20231221), 1zg5_A (3D-footprint 20231221), 1zg5_B (3D-footprint 20231221), 1zg5_F (3D-footprint 20231221) |
| Names: | NARL_ECOLI, Nitrate/Nitrite Response Regulator Protein NARL |
| Organisms: | Escherichia coli, strain K12 |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0AF28 |
| Length: | 66 |
| Pfam Domains: | 4-59 Bacterial regulatory proteins, luxR family 4-49 Sigma-70, region 4 4-48 Sigma-70, region 4 8-47 Winged helix-turn-helix DNA-binding |
| Sequence: (in bold interface residues) | 1 RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWV 60 61 HQERIF |
| Interface Residues: | 33, 34, 35, 36, 38, 39, 40, 41, 42, 47, 48, 50, 51, 52 |
| 3D-footprint Homologues: | 7ve5_B, 4m6f_A, 5w43_B, 4wuh_B, 1je8_F, 1zlk_A, 8dq1_C |
| Binding Motifs: | 1zg1_E TACT 1je8_AB TACCnAnnnaTGGGTA 1je8_EF TaCCnAnnnnTnGGtA 1je8_F TnGGtA 1zg1_AB TACTnnTnnaTnGGTA 1zg1_EF TACCcATnnangAGTA 1zg5_AB TAmCCCtnnaGnGGtA 1zg5_EF TACCCCtnnAGGGGTA |
| Binding Sites: | 1je8_C / 1je8_D / 1je8_G / 1je8_H 1zg1_C / 1zg1_H 1zg1_D / 1zg1_G 1zg5_C / 1zg5_D / 1zg5_G / 1zg5_H |
| Publications: | Maris AE., Sawaya MR., Kaczor-Grzeskowiak M., Jarvis MR., Bearson SM., Kopka ML., Schroder I., Gunsalus RP., Dickerson RE. Dimerization allows DNA target site recognition by the NarL response regulator. Nat Struct Biol. 9(10):771-8 (2002). [Pubmed] Maris AE., Kaczor-Grzeskowiak M., Ma Z., Kopka ML., Gunsalus RP., Dickerson RE. Primary and secondary modes of DNA recognition by the NarL two-component response regulator. Biochemistry. 44(44):14538-52 (2005). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.