Transcription Factor

Accessions: T090254_1.02 (CISBP 1.02), Q940J1 (JASPAR 2024)
Names: ATHB16, T090254_1.02;, ATB16_ARATH, HD-ZIP protein ATHB-16, Homeobox-leucine zipper protein ATHB-16, Homeodomain transcription factor ATHB-16
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:Homeodomain
Length: 294
Pfam Domains: 59-112 Homeobox domain
114-157 Homeobox associated leucine zipper
Sequence:
(in bold interface residues)
1 MKRLSSSDSMCGLISTSTDEQSPRGYGSNYQSMLEGYDEDATLIEEYSGNHHHMGLSEKK 60
61 RRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDY 120
121 GVLKGQYDSLRHNFDSLRRDNDSLLQEISKIKAKVNGEEDNNNNKAITEGVKEEEVHKTD 180
181 SIPSSPLQFLEHSSGFNYRRSFTDLRDLLPNSTVVEAGSSDSCDSSAVLNDETSSDNGRL 240
241 TPPVTVTGGSFLQFVKTEQTEDHEDFLSGEEACGFFSDEQPPSLHWYSASDHWT
Interface Residues: 58, 60, 61, 62, 64, 98, 99, 101, 102, 105, 106, 109, 110, 112, 113
3D-footprint Homologues: 1puf_A, 6a8r_A, 3l1p_A, 1au7_A, 1nk2_P, 5jlw_D, 2ld5_A, 7q3o_C, 1e3o_C, 1le8_A, 7xrc_C, 2xsd_C, 1ig7_A, 1o4x_A, 1du0_A, 4xrm_B, 3a01_E, 2h1k_B, 1jgg_B, 3rkq_B, 2lkx_A, 6es3_K, 4xrs_G, 3cmy_A, 2hdd_A, 5zfz_A, 4cyc_A, 2r5y_A, 1puf_B, 1fjl_B, 5flv_I, 8g87_X, 1b72_A, 5zjt_E, 4qtr_D, 1zq3_P, 7psx_B, 5hod_A, 3lnq_A, 2hos_A, 6m3d_C
Binding Motifs: M0854_1.02 TAATmATT
MA0951.1 TAATmATT
Publications: Johannesson H., Wang Y., Engstrom P. DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol. 45:63-73 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.