Transcription Factor

Accessions: ZNF454 (humanC2H2ZF-ChIP Feb2015), Q8N9F8 (JASPAR 2024)
Names: ENSG00000178187, Q8N9F8, ZNF454, ZN454_HUMAN
Organisms: Homo sapiens
Libraries: humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2
1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: TF family: C2H2;KRAB experiment: ChIP-seq/MEME/B1H-RC
Length: 522
Pfam Domains: 14-54 KRAB box
178-200 Zinc finger, C2H2 type
178-198 C2H2-type zinc finger
178-200 C2H2-type zinc finger
193-226 Zinc-finger double domain
216-238 C2H2-type zinc finger
216-238 Zinc finger, C2H2 type
216-232 C2H2-type zinc finger
234-254 Zinc-finger double domain
243-264 C2H2-type zinc finger
244-266 C2H2-type zinc finger
244-266 Zinc finger, C2H2 type
258-281 Zinc-finger double domain
272-294 Zinc finger, C2H2 type
287-311 Zinc-finger double domain
300-322 C2H2-type zinc finger
314-338 Zinc-finger double domain
327-348 C2H2-type zinc finger
328-350 C2H2-type zinc finger
328-350 Zinc finger, C2H2 type
343-365 Zinc-finger double domain
356-378 C2H2-type zinc finger
356-378 Zinc finger, C2H2 type
356-376 C2H2-type zinc finger
370-393 Zinc-finger double domain
383-404 C2H2-type zinc finger
384-406 C2H2-type zinc finger
384-406 Zinc finger, C2H2 type
399-421 Zinc-finger double domain
412-432 C2H2-type zinc finger
412-434 C2H2-type zinc finger
412-434 Zinc finger, C2H2 type
426-450 Zinc-finger double domain
439-460 C2H2-type zinc finger
440-462 Zinc finger, C2H2 type
440-462 C2H2-type zinc finger
454-477 Zinc-finger double domain
467-486 C2H2-type zinc finger
468-490 C2H2-type zinc finger
468-490 Zinc finger, C2H2 type
482-506 Zinc-finger double domain
495-518 C2H2-type zinc finger
496-518 C2H2-type zinc finger
496-518 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MAVSHLPTMVQESVTFKDVAILFTQEEWGQLSPAQRALYRDVMLENYSNLVSLGLLGPKP 60
61 DTFSQLEKREVWMPEDTPGGFCLDWMTMPASKKSTVKAEIPEEELDQWTIKERFSSSSHW 120
121 KCASLLEWQCGGQEISLQRVVLTHPNTPSQECDESGSTMSSSLHSDQSQGFQPSKNAFEC 180
181 SECGKVFSKSSTLNKHQKIHNEKNANQKIHIKEKRYECRECGKAFHQSTHLIHHQRIHTG 240
241 EKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPF 300
301 KCNICEKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNE 360
361 CGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKA 420
421 FRDQSALAQHQRIHTGEKPYTCNICEKAFSDHSALTQHKRIHTREKPYKCKICEKAFIRS 480
481 THLTQHQRIHTGEKPYKCNKCGKAFNQTANLIQHQRHHIGEK
Interface Residues: 189, 191, 192, 226, 227, 229, 230, 232, 233, 235, 236, 239, 254, 255, 257, 258, 261, 265, 282, 283, 284, 285, 286, 288, 289, 292, 311, 312, 313, 314, 316, 317, 321, 338, 339, 340, 341, 342, 345, 356, 366, 367, 368, 369, 370, 372, 373, 374, 377, 394, 395, 396, 397, 398, 399, 400, 401, 402, 422, 423, 424, 425, 426, 428, 429, 451, 452, 453, 454, 456, 457, 463, 477, 478, 479, 480, 481, 482, 485, 489, 506, 507, 508, 509, 510, 512, 513
3D-footprint Homologues: 5k5l_F, 1tf3_A, 2i13_A, 2jpa_A, 8cuc_F, 7y3l_A, 8ssq_A, 7w1m_H, 8ssu_A, 1tf6_A, 8gn3_A, 2wbs_A, 5kl3_A, 7y3m_I, 5yj3_D, 5yel_A, 6wmi_A, 5v3j_F, 7eyi_G, 2lt7_A, 6jnm_A, 2gli_A, 1g2f_F, 5ei9_F, 1mey_C, 7txc_E, 2kmk_A, 3uk3_C, 5und_A, 5kkq_D, 4m9v_C, 7ysf_A, 6e94_A, 1ubd_C, 6ml4_A, 6u9q_A, 7n5w_A, 5k5i_A, 6blw_A, 2drp_D, 1f2i_J, 4x9j_A, 8h9h_G, 6a57_A, 1llm_D
Binding Motifs: UN0193.1 TrGCGCCGGCGCyw
UN0192.1 trGCGCCwGGCGCya
ZNF454_ChIP AArGCwC
MA1712.1 aGGCTCssGGcCCykvkG
MA1712.2 GGCTCssGGcCCykvkG
Publications: Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.