Transcription Factor

						

			
Accessions: sens2 (FlyZincFinger 1.0 )

			
Names: CG31632
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 190
Pfam Domains:     15-38 Zinc finger, C2H2 type
    30-55 Zinc-finger double domain
    44-62 Zinc-finger of C2H2 type
    44-66 Zinc finger, C2H2 type
    44-66 C2H2-type zinc finger
    44-67 C2H2-type zinc finger
    58-83 Zinc-finger double domain
    71-90 C2H2-type zinc finger
    72-94 Zinc finger, C2H2 type
    72-94 C2H2-type zinc finger
   87-110 Zinc-finger double domain
  100-118 C2H2-type zinc finger
  100-122 Zinc finger, C2H2 type
  100-109 C2H2-type zinc finger
  115-138 Zinc-finger double domain
  127-150 C2H2-type zinc finger
  128-150 C2H2-type zinc finger
  128-150 Zinc finger, C2H2 type
  142-165 Zinc-finger double domain
  156-179 C2H2-type zinc finger
  156-179 Zinc finger, C2H2 type
  156-179 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 MAAKWPGLHQFSDLYSCMKCEKMFSTPHGLEVHSRRTHHGKKPYACELCNKTFGHEVSLS   60
  61 QHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKRFHQKSDMKKHTY  120
 121 IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGYKPFSCKLCHKAFQRKVDLRRHKETQHT  180
 181 DLRVHLGKVD
Interface Residues: 26, 28, 29, 32, 54, 55, 56, 57, 58, 61, 64, 65, 72, 82, 83, 84, 85, 86, 88, 89, 91, 92, 95, 110, 111, 112, 113, 114, 117, 120, 138, 139, 140, 141, 142, 144, 145, 146, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 178
3D-footprint Homologues: 5v3j_F, 8ssu_A, 6wmi_A, 8ssq_A, 8gh6_A, 1tf6_A, 5kkq_D, 5k5i_A, 7w1m_H, 5und_A, 2i13_A, 6e94_A, 7ysf_A, 5yel_A, 2kmk_A, 7n5w_A, 6jnm_A, 6ml4_A, 5ei9_F, 8gn3_A, 2gli_A, 8h9h_G, 7eyi_G, 2lt7_A, 6a57_A, 2jpa_A, 1ubd_C, 1tf3_A, 3uk3_C, 4x9j_A, 1mey_C, 6blw_A, 1f2i_J, 6u9q_A, 7txc_E, 5kl3_A, 1g2f_F, 5k5l_F, 7y3l_A, 8cuc_F, 2wbs_A, 2drp_D, 1llm_D, 4m9v_C, 7y3m_I, 1yuj_A, 5yj3_D
Binding Motifs: sens2_SOLEXA_FBgn0051632 kGCyGTGATTk
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.