Transcription Factor

Accessions: A9Z1E8 (JASPAR 2018), T00324 (AthalianaCistrome v4_May2016)
Names: A9Z1E8_ARATH, AT1G70920, ATHB18, T00324;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2018 1, AthalianaCistrome v4_May2016 2
1 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:Homeobox
Length: 206
Pfam Domains: 67-122 Homeobox domain
124-167 Homeobox associated leucine zipper
Sequence:
(in bold interface residues)
1 MALSPNSSSLDLTISIPSFSPSPSLGDHHGMRDFDINQTPKTEEDREWMIGATPHVNEDD 60
61 SNSGGRRRKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRAR 120
121 SKLKHTEMECEYLKRWFGSLKEQNRRLQIEVEELRALKPSSTSALTMCPRCERVTDAVDN 180
181 DSNAVQEGAVLSSRSRMTISSSSSLC
Interface Residues: 67, 68, 69, 70, 72, 108, 109, 111, 112, 115, 116, 119, 120, 121
3D-footprint Homologues: 2h1k_B, 4rdu_A, 1puf_A, 2me6_A, 3cmy_A, 3d1n_M, 1fjl_B, 2lkx_A, 3lnq_A, 2r5z_A, 1zq3_P, 1nk3_P, 5lux_L, 2ld5_A, 3l1p_A, 5hod_A, 1puf_B, 3rkq_B, 5eea_B, 1k61_B, 1gt0_C, 1le8_B, 5jlw_D, 1au7_A, 1le8_A, 1ig7_A, 1e3o_C, 2xsd_C, 5z2t_D, 4cyc_B, 3a01_E, 2hdd_A, 6es3_K, 1b72_A, 4xrm_B, 4qtr_D, 4xrs_G, 1jgg_B, 4rbo_D, 4cyc_A, 2hos_A
Binding Motifs: M0438 / MA1211.1 yyAATyATTrk
M0433 myAATGATTrr
Binding Sites: MA1211.1.1
MA1211.1.4 / MA1211.1.2
MA1211.1.3
MA1211.1.10
MA1211.1.11
MA1211.1.12
MA1211.1.13
MA1211.1.14
MA1211.1.15
MA1211.1.16
MA1211.1.17
MA1211.1.18
MA1211.1.19
MA1211.1.20
MA1211.1.5
MA1211.1.6
MA1211.1.7
MA1211.1.8
MA1211.1.9
Publications: Johannesson H., Wang Y., Engstrom P. DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol. 45:63-73 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.