Transcription Factor
| Accessions: | UP00548A (UniPROBE 20160601), P22980 (JASPAR 2024) |
| Names: | Helix Loop Helix Protein 1, HLH-1, MyoD1, Helix-loop-helix protein 1, Myoblast determination protein 1 homolog, MyoD protein 1, MYOD1_CAEEL |
| Organisms: | Caenorhabditis elegans |
| Libraries: | UniPROBE 20160601 1, JASPAR 2024 2 1 Hume MA, Barrera LA, Gisselbrecht SS, Bulyk ML. UniPROBE, update 2015: new tools and content for the online database of protein-binding microarray data on protein-DNA interactions. Nucleic Acids Res : (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | P22980 |
| Description: | Helix Loop Helix Protein 1: hlh-1 encodes a basic helix-loop-helix (bHLH) transcription factor that is the C. elegans ortholog of the myogenic regulatory factor (MRF) subgroup of bHLH proteins; in C. elegans, HLH-1 activity is required during embryogenesis for proper bodywall muscle development and function, but not for bodywall muscle cell fate specification, per se: hlh-1 null mutants generate the normal number of bodywall muscle cells, but the arrangement of these cells is disrupted and mutant animals |
| Length: | 324 |
| Pfam Domains: | 156-207 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MNTETSTQSAPSDTYDTSIYYNSSPRVTANDITTLTSFAAPAPQVLDYANTQYDIYRNQP 60 61 AYYLPSYAPTAPTTFYSDFANFNVTRSQDFASVPAVANSSDVKPIIIKQEKSTPNATELI 120 121 IQSRVDSQHEDTTTSTAGGAGVGGPRRTKFVLSVDRRKAATMRERRRLRKVNEAFEVVKQ 180 181 RTCPNPNQRLPKVEILRSAIDYINNLERMLQQAGKMTKIMEQNQHLQMTQQINGAPPHDY 240 241 VTSSHFASSSYNPENMFDDDDLTDSDDDRDHHKLGNAVDLRRRNSLDRLSRIVASIPNEE 300 301 AMTDEQLLQPANDVIDGEKKLEML |
| Interface Residues: | 157, 160, 161, 163, 164, 165, 167, 168, 184, 185, 188, 189, 192, 198 |
| 3D-footprint Homologues: | 2ypa_A, 7z5k_B, 6od3_F, 2ql2_A, 2ql2_D, 2ypa_B, 8i54_A, 5xut_A |
| Binding Motifs: | PL0019.1 ksrACAGCTGTyrwrr MA0545.1 sAACAGCTGwY UP00548A_1 sGgamrGrCACGTGtCsyhCysy MA0545.2 AACAGCTGwY |
| Binding Sites: | AACACCTG AACAGCTG AACAGGTG AACAGTTG ACAACTGT ACACCTGC ACACCTGT ACAGCTGC ACAGCTGT ACAGGCGC ACAGGTGC AGCAGCTG AGCAGGTG CAACTGTC CACCTGTC CAGCTGAC CAGCTGTC GCAGCTGC AACAGGCG ACAGTTGC MA0545.1.1 MA0545.1.10 MA0545.1.11 MA0545.1.12 MA0545.1.13 MA0545.1.14 MA0545.1.15 MA0545.1.16 MA0545.1.17 MA0545.1.18 MA0545.1.19 MA0545.1.2 MA0545.1.20 MA0545.1.3 MA0545.1.4 MA0545.1.5 MA0545.1.6 MA0545.1.7 MA0545.1.8 MA0545.1.9 MA0545.2.1 MA0545.2.10 MA0545.2.11 MA0545.2.12 MA0545.2.13 MA0545.2.14 MA0545.2.15 MA0545.2.16 MA0545.2.17 MA0545.2.18 MA0545.2.19 MA0545.2.2 MA0545.2.20 MA0545.2.3 MA0545.2.4 MA0545.2.5 MA0545.2.6 MA0545.2.7 MA0545.2.8 MA0545.2.9 |
| Publications: | De Masi F, Grove CA, Vedenko A, Alibés A, Gisselbrecht SS, Serrano L, Bulyk ML, Walhout AJ. Using a structural and logics systems approach to infer bHLH-DNA binding specificity determinants. Nucleic Acids Res 39:4553-63 (2011). [Pubmed] Blackwell T. K., Bowerman B., Priess J. R., Weintraub H. Formation of a monomeric DNA binding domain by Skn-1 bZIP and homeodomain elements. Science 266:621-628 (1994). [Pubmed] Grove C.A, De Masi F, Barrasa M.I, Newburger D.E, Alkema M.J, Bulyk M.L, Walhout A.J. A multiparameter network reveals extensive divergence between C. elegans bHLH transcription factors. Cell 138:314-27 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.