Transcription Factor
| Accessions: | BCL6 (HT-SELEX2 May2017) |
| Names: | BCL6, ENSG00000113916 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: BTB/POZ_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 2, TF family: BTB/POZ_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 2 |
| Length: | 200 |
| Pfam Domains: | 33-57 Zinc-finger double domain 46-69 C2H2-type zinc finger 47-69 Zinc finger, C2H2 type 47-69 C2H2-type zinc finger 61-85 Zinc-finger double domain 75-97 Zinc finger, C2H2 type 75-86 C2H2-type zinc finger 75-95 Zinc-finger of C2H2 type 75-94 C2H2-type zinc finger 89-113 Zinc-finger double domain 102-113 C2H2-type zinc finger 103-125 Zinc finger, C2H2 type 103-125 C2H2-type zinc finger 117-142 Zinc-finger double domain 131-153 C2H2-type zinc finger 131-153 Zinc finger, C2H2 type 131-150 C2H2-type zinc finger 133-152 Zinc-finger of C2H2 type 146-169 Zinc-finger double domain 159-182 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 EMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKG 60 61 NLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRA 120 121 HVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQ 180 181 KHGAITNTKVQYRVSATDLP |
| Interface Residues: | 30, 32, 33, 36, 57, 58, 59, 60, 61, 63, 64, 66, 67, 68, 70, 75, 85, 86, 87, 88, 89, 91, 92, 95, 96, 113, 114, 115, 116, 117, 119, 120, 141, 142, 143, 144, 145, 146, 147, 148, 149, 151, 152, 169, 170, 171, 172, 173, 174, 175, 176, 177 |
| 3D-footprint Homologues: | 6wmi_A, 7w1m_H, 5k5l_F, 1tf6_A, 5v3j_F, 5yel_A, 1ubd_C, 8cuc_F, 7n5w_A, 1mey_C, 5kl3_A, 8ssq_A, 2gli_A, 8ssu_A, 6ml4_A, 8gn3_A, 5kkq_D, 8h9h_G, 7eyi_G, 2i13_A, 2jpa_A, 2kmk_A, 1tf3_A, 6jnm_A, 6u9q_A, 5ei9_F, 5und_A, 1g2f_F, 4x9j_A, 1llm_D, 6blw_A, 7y3m_I, 6e94_A, 7ysf_A, 2lt7_A, 7y3l_A, 7txc_E, 2drp_D, 1f2i_J, 5yj3_D, 5k5i_A, 6a57_A, 3uk3_C, 2wbs_A, 4m9v_C |
| Binding Motifs: | BCL6_3 wyGCTTTCkAGGAAyk BCL6_4 rbGyaaTCGAGGAAtt BCL6_methyl_1 wTGCTTTCTAGGAAtt BCL6_methyl_2 ryGywwTCtAGGAAtt |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.