Transcription Factor

Accessions: A4IFQ3 (JASPAR 2018)
Names: A4IFQ3_BOVIN
Organisms: Homo sapiens
Libraries: JASPAR 2018 1
1 [Pubmed]
Uniprot: A4IFQ3
Length: 161
Sequence: MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPL
CVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGGGGGGGAGAGE
GAPQGCKCASLSSAKCSEDDDEVPMSPSSSGKDDRDLTVTP
Binding Motifs: MA0892.1 mcymATTArh
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.