Transcription Factor
Accessions: | T061534_1.02 (CISBP 1.02), Q03125 (JASPAR 2024) |
Names: | NRG1, T061534_1.02;, NRG1_YEAST, Transcriptional regulator NRG1, Zinc finger protein MSS1 |
Organisms: | Saccharomyces cerevisiae |
Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Notes: | experiment type:PBM, family:C2H2 ZF |
Length: | 231 |
Pfam Domains: | 174-196 Zinc finger, C2H2 type 174-192 C2H2-type zinc finger 188-214 Zinc-finger double domain 202-226 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKH 60 61 KLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSVQYNSDSSEKSSLSQLT 120 121 CNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICA 180 181 RGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKGQ |
Interface Residues: | 162, 164, 165, 168, 184, 185, 186, 187, 188, 190, 191, 192, 195, 214, 215, 216, 217, 218, 220, 221, 222, 223, 225 |
3D-footprint Homologues: | 2jpa_A, 5kl3_A, 7n5w_A, 5v3j_F, 3uk3_C, 2kmk_A, 7ysf_A, 1g2f_F, 7w1m_H, 6jnm_A, 8cuc_F, 7y3l_A, 6ml4_A, 1ubd_C, 8gn3_A, 6blw_A, 5ei9_F, 1mey_C, 6u9q_A, 2drp_D, 1f2i_J, 7txc_E, 6e94_A, 5kkq_D, 6wmi_A, 5yj3_D, 2gli_A, 8ssq_A, 4x9j_A, 2i13_A, 8ssu_A, 1llm_D, 5und_A, 8h9h_G, 4m9v_C, 7eyi_G, 7y3m_I, 1tf3_A, 2lt7_A, 1tf6_A, 6a57_A, 2wbs_A |
Binding Motifs: | MA0347.1 ytvrrymAGGGTCCwtbgcw M0505_1.02 wmaGGGwcy MA0347.2 dwmAGGGTCCdwt MA0347.3 mAGGGTCC |
Binding Sites: | MA0347.3.20 / MA0347.3.7 MA0347.3.6 MA0347.3.5 MA0347.3.19 MA0347.3.14 / MA0347.3.16 / MA0347.3.18 / MA0347.3.8 MA0347.3.13 / MA0347.3.15 MA0347.2.1 / MA0347.2.2 MA0347.2.10 / MA0347.2.14 MA0347.2.11 / MA0347.2.15 MA0347.2.12 / MA0347.2.16 MA0347.2.13 / MA0347.2.15 / MA0347.2.17 / MA0347.2.19 MA0347.2.14 / MA0347.2.18 MA0347.2.16 / MA0347.2.20 MA0347.2.17 MA0347.2.18 MA0347.2.19 MA0347.2.2 / MA0347.2.4 MA0347.2.20 MA0347.2.3 / MA0347.2.5 MA0347.2.4 / MA0347.2.6 MA0347.2.5 / MA0347.2.7 MA0347.2.6 / MA0347.2.8 MA0347.2.7 / MA0347.2.9 MA0347.2.10 / MA0347.2.8 MA0347.2.12 / MA0347.2.9 MA0347.2.1 MA0347.2.11 MA0347.2.13 MA0347.2.3 MA0347.3.1 MA0347.3.10 / MA0347.3.11 / MA0347.3.2 / MA0347.3.3 MA0347.3.12 MA0347.3.17 / MA0347.3.4 MA0347.3.9 |
Publications: | Newburger D.E, Bulyk M.L. UniPROBE: an online database of protein binding microarray data on protein-DNA interactions. Nucleic acids research 37:D77-82 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.