Transcription Factor
| Accessions: | 1nvp_A (3D-footprint 20231221), 1tgh_A (3D-footprint 20231221), 5fur_A (3D-footprint 20231221), 6mzm_T (3D-footprint 20231221) |
| Names: | TATA box binding protein, TATA sequence-binding protein, TATA-binding factor, TATA-box factor, TATA-box-binding protein, TBP_HUMAN, Transcription initiation factor TFIID TBP subunit, TATA BINDING PROTEIN (TBP) |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P20226 |
| Length: | 180 |
| Pfam Domains: | 5-87 Transcription factor TFIID (or TATA-binding protein, TBP) 93-177 Transcription factor TFIID (or TATA-binding protein, TBP) |
| Sequence: (in bold interface residues) | 1 SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGK 60 61 MVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQ 120 121 QFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKT 180 |
| Interface Residues: | 9, 11, 39, 40, 54, 56, 62, 64, 98, 99, 101, 130, 131, 145, 147, 153, 155 |
| 3D-footprint Homologues: | 7z7n_D, 1qna_B, 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D, 6cnb_R, 1cdw_A, 5iy6_P |
| Binding Motifs: | 1nvp_AC CTTTTATAnnCC 1tgh_A gTATATATA 5fur_ACGI CTTTTATA 6mzm_ABTW TATAAAAGnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnCnnnCnGA |
| Binding Sites: | 1nvp_E 1nvp_F 1tgh_B / 1tgh_C 5fur_E / 6mzm_V 5fur_F / 6mzm_U |
| Publications: | Bleichenbacher M, Tan S, Richmond T.J. Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes. Journal of molecular biology 332:783-93 (2003). [Pubmed] Juo Z.S, Chiu T.K, Leiberman P.M, Baikalov I, Berk A.J, Dickerson R.E. How proteins recognize the TATA box. Journal of molecular biology 261:239-54 (1996). [Pubmed] Louder RK, He Y, López-Blanco JR, Fang J, Chacón P, Nogales E. Structure of promoter-bound TFIID and model of human pre-initiation complex assembly. Nature 531:604-9 (2016). [Pubmed] Patel AB, Louder RK, Greber BJ, Grünberg S, Luo J, Fang J, Liu Y, Ranish J, Hahn S, Nogales E. Structure of human TFIID and mechanism of TBP loading onto promoter DNA. Science : (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.