Transcription Factor
| Accessions: | T015182_1.02 (CISBP 1.02), O54792 (JASPAR 2024) |
| Names: | Hes2, T015182_1.02;, Hairy and enhancer of split 2, HES2_MOUSE, Transcription factor HES-2 |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:bHLH |
| Length: | 157 |
| Pfam Domains: | 15-68 Helix-loop-helix DNA-binding domain 84-123 Hairy Orange |
| Sequence: (in bold interface residues) | 1 MRLPRRVEDAAELRKNLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRSSKLEKADIL 60 61 EMTVRFLQEQPATLYSSAAPGPLNSYLEGYRACLARLARVLPACSVLEPAVSARLLEHLR 120 121 QRTVSDDSPSLTLPPAPAPAPSPPVPPPGSSGLWRPW |
| Interface Residues: | 17, 21, 22, 25, 26, 53 |
| 3D-footprint Homologues: | 1an4_A, 4h10_A, 1am9_A, 5eyo_A, 8osl_P |
| Binding Motifs: | M0199_1.02 twwcGrMACGTGc MA0616.1 twwcGrMACGTGc |
| Publications: | Ishibashi M, Sasai Y, Nakanishi S, Kageyama R. Molecular characterization of HES-2, a mammalian helix-loop-helix factor structurally related to Drosophila hairy and Enhancer of split. Eur J Biochem 215:645-52 (1993). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.