Transcription Factor
Accessions: | D19A (FlyZincFinger 1.0 ) |
Names: | CG10269 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 120 |
Pfam Domains: | 31-54 Zinc finger, C2H2 type 31-51 C2H2-type zinc finger 45-70 Zinc-finger double domain 60-79 C2H2-type zinc finger 75-98 Zinc-finger double domain 88-110 C2H2-type zinc finger 88-110 Zinc finger, C2H2 type 88-110 Zinc-finger double-stranded RNA-binding 88-108 Zinc-finger of C2H2 type |
Sequence: (in bold interface residues) | 1 QLAGTAVNPIPSVSVPSWSPQVNFTKKEGQHICPGCGRGFNNIGNMKLHYKIIHEKVKDF 60 61 ACRFCPKRFSKAQILRHHEWIHTGEKPFECKICGKHFRQETALKKHIKTHEKPNRRHVPE 120 |
Interface Residues: | 22, 23, 26, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 52, 55, 70, 71, 72, 73, 74, 76, 77, 78, 84, 85, 98, 99, 100, 101, 102, 103, 104, 105, 106, 109 |
3D-footprint Homologues: | 2i13_A, 7n5w_A, 1tf3_A, 6jnm_A, 1mey_C, 6blw_A, 5kl3_A, 5yel_A, 5ei9_F, 6e94_A, 2drp_D, 7ysf_A, 1g2f_F, 6wmi_A, 2kmk_A, 8ssq_A, 1tf6_A, 7w1m_H, 5und_A, 2gli_A, 5kkq_D, 8ssu_A, 1ubd_C, 4x9j_A, 8h9h_G, 7eyi_G, 2lt7_A, 6a57_A, 2jpa_A, 5no6_N, 3uk3_C, 8cuc_F, 7y3l_A, 2wbs_A, 1f2i_J, 6u9q_A, 5k5i_A, 1llm_D, 6ml4_A, 5v3j_F, 4m9v_C, 7y3m_I, 8gn3_A, 1yuj_A, 7txc_E, 5yj3_D |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.