Transcription Factor

						

			
Accessions: 3kov_A (3D-footprint 20231221), 3kov_B (3D-footprint 20231221), 3kov_I (3D-footprint 20231221), 3kov_J (3D-footprint 20231221), 3p57_A (3D-footprint 20231221), 3p57_B (3D-footprint 20231221), 3p57_C (3D-footprint 20231221), 3p57_D (3D-footprint 20231221), 3p57_I (3D-footprint 20231221), 3p57_J (3D-footprint 20231221)

			
Names: MEF2A_HUMAN, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q02078
Length: 90
Pfam Domains:      9-58 SRF-type transcription factor (DNA-binding and dimerisation domain)
Sequence: 
(in bold interface residues)		   1 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD   60
  61 MDKVLLKYTEYNEPHESRTNSDIVEALNKK
Interface Residues: 2, 3, 14, 17, 18, 22, 56, 67
3D-footprint Homologues: 1n6j_A, 1c7u_A, 7x1n_C, 1hbx_A, 1mnm_A, 7yq3_E
Binding Motifs: 3kov_AB TTAnnnnnAG
3kov_IJ TTnnnnnTAG
3p57_AB TAnnnnTAG
3p57_CD CTannnntAA
3p57_IJ CTAnnnnTAA
Binding Sites: 3kov_C / 3kov_K
3kov_D / 3kov_L
3p57_E / 3p57_G / 3p57_K
3p57_F / 3p57_H / 3p57_L
			
Publications: Wu Y, Dey R, Han A, Jayathilaka N, Philips M, Ye J, Chen L. Structure of the MADS-box/MEF2 domain of MEF2A bound to DNA and its implication for myocardin recruitment. Journal of molecular biology 397:520-33 (2010). [Pubmed]


He J, Ye J, Cai Y, Riquelme C, Liu J.O, Liu X, Han A, Chen L. Structure of p300 bound to MEF2 on DNA reveals a mechanism of enhanceosome assembly. Nucleic acids research 39:4464-74 (2011). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.