Transcription Factor

Accessions: T090551_1.02 (CISBP 1.02), A8X4D9 (JASPAR 2018)
Names: Cbr-dsc-1, T090551_1.02;, A8X4D9_CAEBR
Organisms: Caenorhabditis briggsae
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Khan A, Fornes O, Stigliani A, Gheorghe M, Castro-Mondragon JA, van der Lee R, Bessy A, Cheneby , Kulkarni SR, Tan G, Baranasic D, Arenillas DJ, Sandelin A, Vandepoele K, Lenhard B, Ballester B, Wasserman WW, Parcy F, Mathelier A (2017) JASPAR 2018: update of the open-access database of transcription factor binding profiles and its web framework. Nucleic Acids Res. doi: 10.1093/nar/gkx1126 [Pubmed]
Notes: experiment type:PBM, family:Homeodomain
Length: 311
Pfam Domains: 181-237 Homeobox domain
Sequence:
(in bold interface residues)
1 MDPNTNLSNVFDFPDLPMALPKIEIPDTPEFPMHSPSLDLQHFDPPRNLVPHLARRWSCD 60
61 DSKHAVDELPASYYHNLGFALHNHIQMSNQRYLSDFNCPSTVSTIPSAHDSGQLPPLSPY 120
121 DHIGVQDPHLFSSHAYGNSMIPDSSYFDNGSRSISAPTIGNPVIISSAMSSGNSQSCGGK 180
181 RRFRTNFTEHQSLFLEDSFKESHYPDHKAKRHMADFLNIPEDRITVWFQNRRAKWRRKEH 240
241 RQRDHNRSTETFSNTPNTSFDYPCFAGHSNQEADVKPMPGIYPDPAQQGSHDQFQLPPLS 300
301 NATAAFLKNLD
Interface Residues: 181, 182, 183, 184, 222, 223, 225, 226, 229, 230, 233, 234, 237
3D-footprint Homologues: 2h1k_B, 1ig7_A, 1puf_A, 4rdu_A, 2me6_A, 1fjl_B, 3cmy_A, 3d1n_M, 1nk3_P, 2lkx_A, 1jgg_B, 3lnq_A, 2r5z_A, 1zq3_P, 6es3_K, 5lux_L, 2ld5_A, 1b72_A, 5eea_B, 4cyc_A, 3l1p_A, 5hod_A, 3a01_E, 2hdd_A, 1puf_B, 5jlw_D, 2hos_A, 4xrs_G, 3rkq_B, 1gt0_C, 2xsd_C, 1e3o_C, 4j19_B, 1le8_A, 1au7_A, 5z2t_D, 4rbo_D, 4cyc_B, 4qtr_D
Binding Motifs: M0870_1.02 ryTAATTAry
MA0919.1 ryTAATTAry
Publications: Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.