Transcription Factor

Accessions: T003431_1.02 (CISBP 1.02), A9RGN0 (JASPAR 2018)
Names: gw1.8.141.1, T003431_1.02;, A9RGN0_PHYPA, Fragment, Predicted protein
Organisms: Physcomitrella patens, moss
Libraries: CISBP 1.02 1, JASPAR 2018 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 [Pubmed]
Notes: experiment type:PBM, family:AP2
Length: 89
Pfam Domains: 8-58 AP2 domain
Sequence:
(in bold interface residues)
1 EETPSASPKYRGVRMRQWGKWVSEIREPNKRSRIWLGSFPTAEMAARAYDAAVVCLRGPH 60
61 AALNFPDSPPQSLPECHSPKDIQVAAAAA
Interface Residues: 14, 16, 18, 22, 24, 26, 31, 32, 33, 35
3D-footprint Homologues: 1gcc_A, 3rmp_A
Binding Motifs: M0075_1.02 kGTCGGTG
MA1023.1 kGTCGGTG
Publications: Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed]

Disclaimer

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research.