Transcription Factor
| Accessions: | ALX3_DBD (HumanTF 1.0), ALX3 (HT-SELEX2 May2017) |
| Names: | ALX3, ALX3_HUMAN, Homeobox protein aristaless-like 3, Proline-rich transcription factor ALX3, ENSG00000156150 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | O95076 |
| Notes: | Ensembl ID: ENSG00000156150; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 134 |
| Pfam Domains: | 48-104 Homeobox domain |
| Sequence: (in bold interface residues) | 1 PLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLE 60 61 ELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTA 120 121 AYDISVLPRTDSHP |
| Interface Residues: | 47, 48, 49, 50, 51, 89, 90, 92, 93, 96, 97, 100, 101, 104 |
| 3D-footprint Homologues: | 4j19_B, 1ig7_A, 5zfz_A, 2h1k_B, 1puf_A, 3cmy_A, 1fjl_B, 6a8r_A, 3d1n_M, 1zq3_P, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 1nk2_P, 2ld5_A, 1b72_A, 5jlw_D, 4cyc_A, 6es3_K, 4xrs_G, 3l1p_A, 3a01_E, 5flv_I, 5zjt_E, 2hdd_A, 7psx_B, 1au7_A, 5hod_A, 3rkq_B, 2r5y_A, 1puf_B, 2hos_A, 7q3o_C, 2xsd_C, 7xrc_C, 1e3o_C, 1le8_A, 1o4x_A, 1du0_A, 8g87_X, 4qtr_D, 4xrm_B |
| Binding Motifs: | ALX3_DBD rcyAATTArc ALX3_3 cyAATTAa ALX3_6 cyAATTAv ALX3_methyl_1 cyAATTAm ALX3_methyl_2 ckcrTTAr ALX3_methyl_4 cyAATTAm ALX3_methyl_5 mwCrTTAr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.