Transcription Factor
| Accessions: | ECK120006817 (RegulonDB 7.5) |
| Names: | GntR, GntR DNA-binding transcriptional repressor |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The Gluconate repressor,GntR, is a transcription factor that negatively regulates the operon involved in the catabolism of d-gluconate via the Entner-Doudoroff pathway and also represses genes involved in two different systems related to d-gluconate uptake: gluconate I and gluconate II Rodionov DA,2000; Tsunedomi R,2003; Bausch C,1998; This regulator is part of the gntRKU operon, yet it can also be constitutively expressed as an independent ARRAY(0x2431180) transcription unit Izu H,1997; Tong S,1996; Gluconate I is considered the main system for transport of d-gluconate and contains genes that encode high- and low-affinity gluconate transporters Rodionov DA,2000; Porco A,1997; Porco A,1998; Izu H,1997; Peekhaus N,1998; The d-gluconate II system is capable of transport of l-idonate and also is regulated by IdnR; the genes involved in this system encode another high-affinity gluconate transporter Rodionov DA,2000; In addition, the genes regulated are induced when Escherichia coli is grown in the presence of the inductor, d-gloconate, and in the absence of glucose; In the absence of inductor, this repressor binds in tandem to inverted repeat sequences that consist of 20-nucleotide-long DNA target sites Rodionov DA,2000; Binding of GntR to DNA is diminished in the presence of the inducer d-gluconate; GntR is closely homologous to IdnR ARRAY(0x2409e78) and belongs to the LacI/GalR family of transcriptional regulators Rodionov DA,2000; Accordingly, this transcriptional repressor family protein is composed of two domains: a conserved N-terminal domain which contains the DNA-binding region, and the carboxy-terminal domain, which is involved in effector binding and oligomerization Izu H,1997."; intracellular; transcription repressor activity; sequence-specific DNA binding transcription factor activity; DNA binding; regulation of transcription, DNA-dependent; cytoplasm; operon; repressor; Transcription related; transcription, DNA-dependent |
| Length: | 332 |
| Pfam Domains: | 8-52 Bacterial regulatory proteins, lacI family 64-309 Periplasmic binding proteins and sugar binding domain of LacI family 66-275 Periplasmic binding protein domain 176-330 Periplasmic binding protein-like domain |
| Sequence: (in bold interface residues) | 1 MKKKRPVLQDVADRVGVTKMTVSRFLRNPEQVSVALRGKIAAALDELGYIPNRAPDILSN 60 61 ATSRAIGVLLPSLTNQVFAEVLRGIESVTDAHGYQTMLAHYGYKPEMEQERLESMLSWNI 120 121 DGLILTERTHTPRTLKMIEVAGIPVVELMDSKSPCLDIAVGFDNFEAARQMTTAIIARGH 180 181 RHIAYLGARLDERTIIKQKGYEQAMLDAGLVPYSVMVEQSSSYSSGIELIRQARREYPQL 240 241 DGVFCTNDDLAVGAAFECQRLGLKVPDDMAIAGFHGHDIGQVMEPRLASVLTPRERMGSI 300 301 GAERLLARIRGESVTPKMLDLGFTLSPGGSI* |
| Interface Residues: | 8, 9, 18, 19, 20, 21, 23, 24, 30, 31, 32, 55, 58, 59 |
| 3D-footprint Homologues: | 3oqm_C, 7ce1_D, 1efa_B, 1l1m_B, 1zvv_A, 5k98_B, 3dnv_B, 6chv_D, 1jft_A, 4z5h_A |
| Binding Motifs: | GntR vayGTtAcscgTAwCAkw |
| Binding Sites: | ECK120012098 ECK120012120 ECK120012135 ECK120012203 ECK120012206 ECK120012209 ECK120012213 ECK120013292 ECK120013294 ECK120015288 |
| Publications: | Izu H., Adachi O., Yamada M. Gene organization and transcriptional regulation of the gntRKU operon involved in gluconate uptake and catabolism of Escherichia coli. J Mol Biol. 267(4):778-93 (1997). [Pubmed] Peekhaus N., Conway T. Positive and negative transcriptional regulation of the Escherichia coli gluconate regulon gene gntT by GntR and the cyclic AMP (cAMP)-cAMP receptor protein complex. J Bacteriol. 180(7):1777-85 (1998). [Pubmed] Izu H., Kawai T., Yamada Y., Aoshima H., Adachi O., Yamada M. Characterization of the gntT gene encoding a high-affinity gluconate permease in Escherichia coli. Gene. 199(1-2):203-10 (1997). [Pubmed] Porco A., Alonso G., Isturiz T. The gluconate high affinity transport of GntI in Escherichia coli involves a multicomponent complex system. J Basic Microbiol. 38(5-6):395-404 (1998). [Pubmed] Porco A., Peekhaus N., Bausch C., Tong S., Isturiz T., Conway T. Molecular genetic characterization of the Escherichia coli gntT gene of GntI, the main system for gluconate metabolism. J Bacteriol. 179(5):1584-90 (1997). [Pubmed] Tong S., Porco A., Isturiz T., Conway T. Cloning and molecular genetic characterization of the Escherichia coli gntR, gntK, and gntU genes of GntI, the main system for gluconate metabolism. J Bacteriol. 178(11):3260-9 (1996). [Pubmed] Bausch C., Peekhaus N., Utz C., Blais T., Murray E., Lowary T., Conway T. Sequence analysis of the GntII (subsidiary) system for gluconate metabolism reveals a novel pathway for L-idonic acid catabolism in Escherichia coli. J Bacteriol. 180(14):3704-10 (1998). [Pubmed] Tsunedomi R., Izu H., Kawai T., Matsushita K., Ferenci T., Yamada M. The activator of GntII genes for gluconate metabolism, GntH, exerts negative control of GntR-regulated GntI genes in Escherichia coli. J Bacteriol. 185(6):1783-95 (2003). [Pubmed] Tsunedomi R., Izu H., Kawai T., Yamada M. Dual control by regulators, GntH and GntR, of the GntII genes for gluconate metabolism in Escherichia coli. J Mol Microbiol Biotechnol. 6(1):41-56 (2003). [Pubmed] Rodionov DA., Mironov AA., Rakhmaninova AB., Gelfand MS. Transcriptional regulation of transport and utilization systems for hexuronides, hexuronates and hexonates in gamma purple bacteria. Mol Microbiol. 38(4):673-83 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.