Transcription Factor
| Accessions: | T049080_1.02 (CISBP 1.02), Q5RJ54 (JASPAR 2024) |
| Names: | T049080_1.02;, Zfp187, Zinc finger and SCAN domain-containing protein 26, Zinc finger protein 187, ZSC26_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q5RJ54 |
| Notes: | experiment type:PBM, family:C2H2 ZF |
| Length: | 466 |
| Pfam Domains: | 38-129 SCAN domain 270-292 Zinc finger, C2H2 type 270-290 C2H2-type zinc finger 270-292 C2H2-type zinc finger 284-308 Zinc-finger double domain 298-320 C2H2-type zinc finger 298-320 Zinc finger, C2H2 type 298-310 C2H2-type zinc finger 313-336 Zinc-finger double domain 326-348 C2H2-type zinc finger 328-348 Zinc finger, C2H2 type 340-365 Zinc-finger double domain 354-376 C2H2-type zinc finger 355-376 Zinc finger, C2H2 type 356-376 C2H2-type zinc finger 369-392 Zinc-finger double domain 382-400 C2H2-type zinc finger 382-404 Zinc finger, C2H2 type 397-419 Zinc-finger double domain 410-420 C2H2-type zinc finger 410-432 C2H2-type zinc finger 410-432 Zinc finger, C2H2 type 424-448 Zinc-finger double domain 437-462 C2H2-type zinc finger 438-461 C2H2-type zinc finger 438-460 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MALALIHPSKRAYSLAPLNLKEELQGFKVQGDRKGVGQEPLCKQFRQLRYEESTGPREVL 60 61 RRLRELCRQWLRPETHSKEQILELLVLEQFLTILPRDLQVQVLEHHPETGEELVGILEDL 120 121 QLDRGKAGEQKDSAQRSRPTVLVGEPAPRREAREQPGCALPQKPEERGKETRSENGNLIA 180 181 GTDSCGRMESSCTMTEPIEAQCEDLSLKKNPAMPKEKTNSQCLETKERLVQNSGLIEHDR 240 241 AHTGEMSWESVGSQSSVAADHQEISKDKGHPCQECGKVFQRSSHLIRHQKIHLGEKPYQC 300 301 KECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQKIHSQDEPRECKECG 360 361 KTFSRALLLTHHQRVHGRSKRHHCNECGKAFSLTSDLIRHHRIHTGEKPFKCNVCQKAFR 420 421 LNSHLDQHVRIHNEEKPYKCSECNEAFRQKSGLFQHQRHHHKSKLA |
| Interface Residues: | 280, 281, 282, 283, 284, 286, 287, 289, 290, 291, 293, 308, 309, 310, 311, 312, 314, 315, 316, 336, 337, 338, 339, 340, 341, 342, 343, 344, 347, 364, 365, 366, 367, 368, 369, 370, 371, 392, 393, 394, 395, 396, 398, 399, 405, 419, 420, 421, 422, 423, 424, 425, 427, 431, 448, 449, 450, 451, 452, 454, 455 |
| 3D-footprint Homologues: | 1tf3_A, 6jnm_A, 7n5w_A, 5ei9_F, 1mey_C, 5kl3_A, 7ysf_A, 5k5i_A, 2kmk_A, 8ssq_A, 7w1m_H, 2gli_A, 1g2f_F, 8ssu_A, 1tf6_A, 5v3j_F, 4x9j_A, 2i13_A, 6blw_A, 5kkq_D, 1ubd_C, 8h9h_G, 7eyi_G, 6e94_A, 6wmi_A, 2lt7_A, 6a57_A, 2jpa_A, 7txc_E, 2drp_D, 1f2i_J, 5und_A, 8gn3_A, 1llm_D, 2wbs_A, 4m9v_C, 7y3m_I, 5yel_A, 5yj3_D, 6ml4_A, 8cuc_F, 7y3l_A, 6u9q_A, 3uk3_C, 5k5l_F |
| Binding Motifs: | PB0096.1 ytATGTACyAATwm PB0200.1 grrmCCTtGTyCmywv M0395_1.02 GkACtARK |
| Publications: | Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.