Transcription Factor
| Accessions: | ECK120004869 (RegulonDB 7.5) |
| Names: | GlpR, GlpR DNA-binding transcriptional repressor |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | The sn-Glycerol-3-phosphate repressor,GlpR, acts as the repressor of the glycerol-3-phosphate regulon, which is organized in different operons Larson TJ,1987; Lin EC.,1976; Larson TJ,1992; Yang B,1997; Truniger V,1992; Weissenborn DL,1992; Yang B,1996 ; This regulator is part of the glpEGR operon, yet it can also be constitutively expressed as an independent ARRAY(0x2433490) transcription unit Yang B,1998; Schweizer H,1985 ; In addition, the operons regulated are induced when Escherichia coli is grown in the presence of inductor, glycerol, or glycerol-3-phosphate ARRAY(0x24161c0) , and the absence of glucose Lin EC.,1976; In the absence of inductor, this repressor binds in tandem to inverted repeat sequences that consist of 20-nucleotide-long DNA target sites Zhao N,1994; Lin EC.,1976 ; Binding of GlpR to DNA is diminished in the presence of the inducers glycerol or G3P; GlpR belongs to the DeoR family of transcriptional regulators Zeng G,1996 ; Accordingly, this transcriptional repressor family protein is composed of two domains: a conserved N-terminal domain which contains the DNA-binding region, and the carboxy-terminal domain, which is involved in oligomerization and binding of the inducer Zeng G,1996 ; Resequencing of multiple isolates of the MG1655 strain has identified several genetic variations compared to the reference sequence, including a 1-bp deletion in glpR in strain ATCC700926 Freddolino PL,2012 ; This EcoliWiki page summarizes these sequence differences."; repressor; anaerobic respiration; sequence-specific DNA binding transcription factor activity; intracellular; glycerol metabolic process; regulation of transcription, DNA-dependent; cytoplasm; Transcription related; operon; DNA binding; transcription, DNA-dependent |
| Length: | 253 |
| Pfam Domains: | 6-61 DeoR-like helix-turn-helix domain 6-47 HTH domain 21-56 Bacterial regulatory proteins, gntR family 73-232 DeoR C terminal sensor domain |
| Sequence: (in bold interface residues) | 1 MKQTQRHNGIIELVKQQGYVSTEELVEHFSVSPQTIRRDLNELAEQNLILRHHGGAALPS 60 61 SSVNTPWHDRKATQTEEKERIARKVAEQIPNGSTLFIDIGTTPEAVAHALLNHSNLRIVT 120 121 NNLNVANTLMVKEDFRIILAGGELRSRDGGIIGEATLDFISQFRLDFGILGISGIDSDGS 180 181 LLEFDYHEVRTKRAIIENSRHVMLVVDHSKFGRNAMVNMGSISMVDAVYTDAPPPVSVMQ 240 241 VLTDHHIQLELC* |
| Interface Residues: | 1, 22, 23, 32, 33, 34, 35, 37, 38, 52, 53 |
| 3D-footprint Homologues: | 2p5l_D, 4wwc_B, 4h0e_A, 4u0y_B, 7b5y_B |
| Binding Motifs: | GlpR awATGwkcrawwwCGmrCaw |
| Binding Sites: | ECK120012732 ECK120012734 ECK120012740 ECK120012743 ECK120012746 ECK120012749 ECK120013454 ECK120013456 ECK120013458 ECK120013460 ECK120013462 ECK120013464 ECK120013968 ECK120013970 ECK120015213 ECK120015215 ECK120015217 ECK120015606 |
| Publications: | Zeng G., Ye S., Larson TJ. Repressor for the sn-glycerol 3-phosphate regulon of Escherichia coli K-12: primary structure and identification of the DNA-binding domain. J Bacteriol. 178(24):7080-9 (1996). [Pubmed] Schweizer H., Boos W., Larson TJ. Repressor for the sn-glycerol-3-phosphate regulon of Escherichia coli K-12: cloning of the glpR gene and identification of its product. J Bacteriol. 161(2):563-6 (1985). [Pubmed] Yang B., Larson TJ. Multiple promoters are responsible for transcription of the glpEGR operon of Escherichia coli K-12. Biochim Biophys Acta. 1396(1):114-26 (1998). [Pubmed] Yang B., Larson TJ. Action at a distance for negative control of transcription of the glpD gene encoding sn-glycerol 3-phosphate dehydrogenase of Escherichia coli K-12. J Bacteriol. 178(24):7090-8 (1996). [Pubmed] Weissenborn DL., Wittekindt N., Larson TJ. Structure and regulation of the glpFK operon encoding glycerol diffusion facilitator and glycerol kinase of Escherichia coli K-12. J Biol Chem. 267(9):6122-31 (1992). [Pubmed] Truniger V., Boos W., Sweet G. Molecular analysis of the glpFKX regions of Escherichia coli and Shigella flexneri. J Bacteriol. 174(21):6981-91 (1992). [Pubmed] Freddolino PL., Amini S., Tavazoie S. Newly identified genetic variations in common Escherichia coli MG1655 stock cultures. J Bacteriol. 194(2):303-6 (2012). [Pubmed] Larson TJ., Cantwell JS., van Loo-Bhattacharya AT. Interaction at a distance between multiple operators controls the adjacent, divergently transcribed glpTQ-glpACB operons of Escherichia coli K-12. J Biol Chem. 267(9):6114-21 (1992). [Pubmed] Lin EC. Glycerol dissimilation and its regulation in bacteria. Annu Rev Microbiol. 30:535-78 (1976). [Pubmed] Larson TJ., Ye SZ., Weissenborn DL., Hoffmann HJ., Schweizer H. Purification and characterization of the repressor for the sn-glycerol 3-phosphate regulon of Escherichia coli K12. J Biol Chem. 262(33):15869-74 (1987). [Pubmed] Zhao N., Oh W., Trybul D., Thrasher KS., Kingsbury TJ., Larson TJ. Characterization of the interaction of the glp repressor of Escherichia coli K-12 with single and tandem glp operator variants. J Bacteriol. 176(8):2393-7 (1994). [Pubmed] Yang B., Gerhardt SG., Larson TJ. Action at a distance for glp repressor control of glpTQ transcription in Escherichia coli K-12. Mol Microbiol. 24(3):511-21 (1997). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.