Transcription Factor

						

			
Accessions: GATA4 (Athamap 20091028), T084299_1.02 (CISBP 1.02), T15644 (AthalianaCistrome v4_May2016), O49743 (JASPAR 2024)

			
Names: AtGATA-4, GATA transcription factor 4, GATA4, T084299_1.02;, AT3G60530, T15644;, GATA4_ARATH
Organisms: Arabidopsis thaliana
Libraries: Athamap 20091028 1, CISBP 1.02 2, AthalianaCistrome v4_May2016 3, JASPAR 2024 4
1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009).  [Pubmed]

2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]

3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]

4 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: O49743
Notes: experiment type:PBM, family:GATA, ecotype:Col-0, experiment type: DAP-seq, family:C2C2-GATA
Length: 240
Pfam Domains:   160-194 GATA zinc finger
Sequence: 
(in bold interface residues)		   1 MDVYGMSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLL   60
  61 TDFTHDLCVPSDDAAHLEWLSRFVDDSFSDFPANPLTMTVRPEISFTGKPRSRRSRAPAP  120
 121 SVAGTWAPMSESELCHSVAKPKPKKVYNAESVTADGARRCTHCASEKTPQWRTGPLGPKT  180
 181 LCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRKVMELRRQKEQQESCVRIPPFQPQ  240
Interface Residues: 169, 170, 172, 183, 187, 188, 191, 211
3D-footprint Homologues: 3dfx_B, 3vd6_C, 1gat_A, 4hc9_A, 4gat_A
Binding Motifs: GATA4 ATgAwwmsrC
M0766_1.02 hyrGATCyrd
M0287 wyyyrGATCyrrwyy
MA1755.1 hyrGATCyrd
MA1755.2 GATC
Binding Sites: GATA4_1
GATA4_2
GATA4_3
GATA4_4
GATA4_5
			
Publications: Teakle GR, Manfield IW, Graham JF, Gilmartin PM. 2002. Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics. Plant Mol Biol. 50:43-57. [Pubmed]


O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.