Transcription Factor

Accessions: Q5TA89 (JASPAR 2024)
Names: bHLHb38, Class B basic helix-loop-helix protein 38, Hairy and enhancer of split 5, HES5_HUMAN, Transcription factor HES-5
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q5TA89
Length: 166
Pfam Domains: 18-71 Helix-loop-helix DNA-binding domain
86-122 Hairy Orange
Sequence:
(in bold interface residues)
1 MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD 60
61 ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ 120
121 RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
Interface Residues: 20, 21, 22, 24, 25, 28, 29
3D-footprint Homologues: 1an4_A, 8osl_O, 4h10_B, 4h10_A, 7f2f_B, 8osl_P, 5gnj_I, 7xhv_B, 5nj8_C, 7xi3_B, 5v0l_B
Binding Motifs: MA0821.1 yGrCACGTGCCr
MA0821.2 grCACGTGyc
Publications: Jones S. An overview of the basic helix-loop-helix proteins. Genome Biol : (2004;5(6):226.). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.