Transcription Factor

Accessions: CG10267 (FlyZincFinger 1.0 )
Names: CG10267
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 151
Pfam Domains: 34-56 Zinc finger, C2H2 type
34-56 Zinc-finger of C2H2 type
34-56 C2H2-type zinc finger
49-71 Zinc-finger double domain
62-84 C2H2-type zinc finger
77-101 Zinc-finger double domain
90-112 C2H2-type zinc finger
90-112 Zinc finger, C2H2 type
104-127 Zinc-finger double domain
118-139 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 TEKGGYICDVCGNFYEKRGRMMEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSK 60
61 PYKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRC 120
121 DYCNKDFRLLHHMRQHEETKLHQNAVMLAES
Interface Residues: 17, 18, 19, 20, 22, 23, 25, 26, 27, 29, 34, 44, 45, 46, 47, 48, 51, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83, 100, 101, 102, 103, 104, 105, 106, 107, 108, 111, 125, 127, 128, 129, 130, 131, 132, 134, 135
3D-footprint Homologues: 5ei9_F, 8ssq_A, 5und_A, 8ssu_A, 1tf6_A, 5v3j_F, 5kkq_D, 6u9q_A, 2i13_A, 2jpa_A, 1ubd_C, 2itl_B, 2kmk_A, 3uk3_C, 7y3l_A, 7n5w_A, 4x9j_A, 5kl3_A, 1f2i_J, 7w1m_H, 2gli_A, 1g2f_F, 5k5i_A, 6ml4_A, 6blw_A, 5yel_A, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 7y3m_I, 1tf3_A, 6jnm_A, 8cuc_F, 1mey_C, 2wbs_A, 5yj3_D, 8gn3_A, 1llm_D, 4m9v_C, 2lt7_A, 6a57_A, 7txc_E, 2drp_D
Binding Motifs: CG10267_SANGER_5_FBgn0037446 whyAACACTR
CG10267_SOLEXA_5_FBgn0037446 cakcwwayAACACTAsmmwt
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.